NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17539758|ref|NP_503119|]
View 

Putative glucosylceramidase 3 [Caenorhabditis elegans]

Protein Classification

Glyco_hydro_30 and Glyco_hydro_30C domain-containing protein (domain architecture ID 11719830)

Glyco_hydro_30 and Glyco_hydro_30C domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glyco_hydro_30 super family cl23815
Glycosyl hydrolase family 30 TIM-barrel domain;
104-450 3.08e-144

Glycosyl hydrolase family 30 TIM-barrel domain;


The actual alignment was detected with superfamily member pfam02055:

Pssm-ID: 329099  Cd Length: 348  Bit Score: 422.80  E-value: 3.08e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   104 IFGFGGAFTDSAGDQFVSLSETLQNYIVDSYFGKNGLEYNIGRVPIASCDFSTHEYSYDDVHDDFELKHFALPDEDLKLK 183
Cdd:pfam02055   1 IQGFGSTFSDASGANLKSLPDPAQDLILKQYFSDEGLNLQFGRVPIASCDFSIRVYTYADTPDDYQMHNFSLPEEDTQWK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   184 IPFIKKAiEKTEGNIQLFASPWSAPGWMKVTGRMRGGGAM--RNDKRVYQAYADYFFKFFEAYSSHAITFWGLTIQNEPS 261
Cdd:pfam02055  81 IPYIHRA-QKYNQRLKLFASPWTAPGWLKTTGAVNGKGSLkgQPGDIYHQTYARYFVKFLEEYAKHGIQFWGLSTQNEPT 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   262 TGADMAWRWQTMNYTAETMRDFLKKYLGPKLKENKLTETLKVMVLDDGRGLLPGWADTIFNDPEATKYADGVAVHWYGNL 341
Cdd:pfam02055 160 AGSDKKYKFQSLGFTAEHQRDFIKRDLGPALANSTHGKNVKLLILDDNRGNLPKWADTVLNDPDAAKYVHGIAVHWYQDA 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   342 YSPAVlLDITQRHHPTKFIFGTEACAGY-FGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLCLDETGGPNWAYNV 420
Cdd:pfam02055 240 EADAH-LGETHRLHPNTFIFGTEASEGSkSKDQSVDYGSWDRAMDYSSDILDNLNNWVTGWTERNLALDAEGGPSWVSNF 318
                         330       340       350
                  ....*....|....*....|....*....|
gi 17539758   421 VDSPIIVNRTAQEFYKQPMFYALGHFSKFL 450
Cdd:pfam02055 319 VDAPVIAFPAKAQFYKQPMFYAIAHFSHFI 348
Glyco_hydro_30C pfam17189
Glycosyl hydrolase family 30 beta sandwich domain;
453-516 9.71e-07

Glycosyl hydrolase family 30 beta sandwich domain;


:

Pssm-ID: 319207  Cd Length: 63  Bit Score: 47.54  E-value: 9.71e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 17539758   453 GSTRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGfSIVLNLPPRSIHTV 516
Cdd:pfam17189   1 GAVRIGSSSSGSNNLEAVAFLNPDGSIVLVVLNRSDSDVTFTVKDGGQS-VFSLTLPARSIATF 63
 
Name Accession Description Interval E-value
Glyco_hydro_30 pfam02055
Glycosyl hydrolase family 30 TIM-barrel domain;
104-450 3.08e-144

Glycosyl hydrolase family 30 TIM-barrel domain;


Pssm-ID: 307945  Cd Length: 348  Bit Score: 422.80  E-value: 3.08e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   104 IFGFGGAFTDSAGDQFVSLSETLQNYIVDSYFGKNGLEYNIGRVPIASCDFSTHEYSYDDVHDDFELKHFALPDEDLKLK 183
Cdd:pfam02055   1 IQGFGSTFSDASGANLKSLPDPAQDLILKQYFSDEGLNLQFGRVPIASCDFSIRVYTYADTPDDYQMHNFSLPEEDTQWK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   184 IPFIKKAiEKTEGNIQLFASPWSAPGWMKVTGRMRGGGAM--RNDKRVYQAYADYFFKFFEAYSSHAITFWGLTIQNEPS 261
Cdd:pfam02055  81 IPYIHRA-QKYNQRLKLFASPWTAPGWLKTTGAVNGKGSLkgQPGDIYHQTYARYFVKFLEEYAKHGIQFWGLSTQNEPT 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   262 TGADMAWRWQTMNYTAETMRDFLKKYLGPKLKENKLTETLKVMVLDDGRGLLPGWADTIFNDPEATKYADGVAVHWYGNL 341
Cdd:pfam02055 160 AGSDKKYKFQSLGFTAEHQRDFIKRDLGPALANSTHGKNVKLLILDDNRGNLPKWADTVLNDPDAAKYVHGIAVHWYQDA 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   342 YSPAVlLDITQRHHPTKFIFGTEACAGY-FGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLCLDETGGPNWAYNV 420
Cdd:pfam02055 240 EADAH-LGETHRLHPNTFIFGTEASEGSkSKDQSVDYGSWDRAMDYSSDILDNLNNWVTGWTERNLALDAEGGPSWVSNF 318
                         330       340       350
                  ....*....|....*....|....*....|
gi 17539758   421 VDSPIIVNRTAQEFYKQPMFYALGHFSKFL 450
Cdd:pfam02055 319 VDAPVIAFPAKAQFYKQPMFYAIAHFSHFI 348
XynC COG5520
O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis];
93-519 1.63e-53

O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 227807  Cd Length: 433  Bit Score: 189.34  E-value: 1.63e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758  93 ITIDASERFQNIFGFGGaFTDSAGdqFVSLSETLqnyiVDSYF--GKNGLEYNIGRVPIASCDFSTheysydDVHDDFEL 170
Cdd:COG5520  36 ITVNVAAKHQVIRGFGG-MNSSAW--AGDLSAAQ----LETLFgnGANQLGFSILRVPIDSNDFSL------GGSADNWY 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 171 KHFalpdedlklkiPFIKKAIEKtegNIQLFASPWSAPGWMKVTGRMRGGGAMRNDKRVYQAYADYFFKFFEAYSSHAIT 250
Cdd:COG5520 103 KEL-----------STAKSAINP---GMIVFASPWSPPASMKTTNNRNGGNAGRLKYEKYADYADYLNDFVLEMKNNGVN 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 251 FWGLTIQNEPstgaDMAWRWQTMNYTAETMRDFLKKYLGPKLKENKltetlkvmVLD-DGRGLLPGWADTIFNDPEATKY 329
Cdd:COG5520 169 LYALSVQNEP----DYAPTYDWCWWTPQEELRFMRQYLASINAEMR--------VIIpESFKDLPNMSDPILNDPKALAN 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 330 ADGVAVHWYGNLYS--PAVLldiTQRHHPTKFIFGTEAcagYFGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLC 407
Cdd:COG5520 237 MDILGTHLYGGQVSdqPYPL---AKQKPAGKDLWMTEC---YPPESDPNSADREALHVALHIHIGMTEGGFQAYVWWNIR 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 408 LDETGGPN-------------WAYNVVDSPIIVNRTaqefyKQPmfYALGHFSKFLPRGSTRVFTKIEGNLAVSATSVVI 474
Cdd:COG5520 311 LDYGGGPNhggnskrgycmahFSKFVQNGYVRLDAT-----KSP--YGNVYVSAYVGPNKVVIVAINKGTYPVNQSFNFQ 383
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*.
gi 17539758 475 EG-GRRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIHTVIWK 519
Cdd:COG5520 384 NPdGSNVSSWVNSSTLNMAKTSNILAAGGRFNASLPAQSVTTFVWD 429
Glyco_hydro_30C pfam17189
Glycosyl hydrolase family 30 beta sandwich domain;
453-516 9.71e-07

Glycosyl hydrolase family 30 beta sandwich domain;


Pssm-ID: 319207  Cd Length: 63  Bit Score: 47.54  E-value: 9.71e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 17539758   453 GSTRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGfSIVLNLPPRSIHTV 516
Cdd:pfam17189   1 GAVRIGSSSSGSNNLEAVAFLNPDGSIVLVVLNRSDSDVTFTVKDGGQS-VFSLTLPARSIATF 63
 
Name Accession Description Interval E-value
Glyco_hydro_30 pfam02055
Glycosyl hydrolase family 30 TIM-barrel domain;
104-450 3.08e-144

Glycosyl hydrolase family 30 TIM-barrel domain;


Pssm-ID: 307945  Cd Length: 348  Bit Score: 422.80  E-value: 3.08e-144
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   104 IFGFGGAFTDSAGDQFVSLSETLQNYIVDSYFGKNGLEYNIGRVPIASCDFSTHEYSYDDVHDDFELKHFALPDEDLKLK 183
Cdd:pfam02055   1 IQGFGSTFSDASGANLKSLPDPAQDLILKQYFSDEGLNLQFGRVPIASCDFSIRVYTYADTPDDYQMHNFSLPEEDTQWK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   184 IPFIKKAiEKTEGNIQLFASPWSAPGWMKVTGRMRGGGAM--RNDKRVYQAYADYFFKFFEAYSSHAITFWGLTIQNEPS 261
Cdd:pfam02055  81 IPYIHRA-QKYNQRLKLFASPWTAPGWLKTTGAVNGKGSLkgQPGDIYHQTYARYFVKFLEEYAKHGIQFWGLSTQNEPT 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   262 TGADMAWRWQTMNYTAETMRDFLKKYLGPKLKENKLTETLKVMVLDDGRGLLPGWADTIFNDPEATKYADGVAVHWYGNL 341
Cdd:pfam02055 160 AGSDKKYKFQSLGFTAEHQRDFIKRDLGPALANSTHGKNVKLLILDDNRGNLPKWADTVLNDPDAAKYVHGIAVHWYQDA 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758   342 YSPAVlLDITQRHHPTKFIFGTEACAGY-FGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLCLDETGGPNWAYNV 420
Cdd:pfam02055 240 EADAH-LGETHRLHPNTFIFGTEASEGSkSKDQSVDYGSWDRAMDYSSDILDNLNNWVTGWTERNLALDAEGGPSWVSNF 318
                         330       340       350
                  ....*....|....*....|....*....|
gi 17539758   421 VDSPIIVNRTAQEFYKQPMFYALGHFSKFL 450
Cdd:pfam02055 319 VDAPVIAFPAKAQFYKQPMFYAIAHFSHFI 348
XynC COG5520
O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis];
93-519 1.63e-53

O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 227807  Cd Length: 433  Bit Score: 189.34  E-value: 1.63e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758  93 ITIDASERFQNIFGFGGaFTDSAGdqFVSLSETLqnyiVDSYF--GKNGLEYNIGRVPIASCDFSTheysydDVHDDFEL 170
Cdd:COG5520  36 ITVNVAAKHQVIRGFGG-MNSSAW--AGDLSAAQ----LETLFgnGANQLGFSILRVPIDSNDFSL------GGSADNWY 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 171 KHFalpdedlklkiPFIKKAIEKtegNIQLFASPWSAPGWMKVTGRMRGGGAMRNDKRVYQAYADYFFKFFEAYSSHAIT 250
Cdd:COG5520 103 KEL-----------STAKSAINP---GMIVFASPWSPPASMKTTNNRNGGNAGRLKYEKYADYADYLNDFVLEMKNNGVN 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 251 FWGLTIQNEPstgaDMAWRWQTMNYTAETMRDFLKKYLGPKLKENKltetlkvmVLD-DGRGLLPGWADTIFNDPEATKY 329
Cdd:COG5520 169 LYALSVQNEP----DYAPTYDWCWWTPQEELRFMRQYLASINAEMR--------VIIpESFKDLPNMSDPILNDPKALAN 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 330 ADGVAVHWYGNLYS--PAVLldiTQRHHPTKFIFGTEAcagYFGHHGPIMGDWFRAESYADDIITDLNHHVTGWTDWNLC 407
Cdd:COG5520 237 MDILGTHLYGGQVSdqPYPL---AKQKPAGKDLWMTEC---YPPESDPNSADREALHVALHIHIGMTEGGFQAYVWWNIR 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17539758 408 LDETGGPN-------------WAYNVVDSPIIVNRTaqefyKQPmfYALGHFSKFLPRGSTRVFTKIEGNLAVSATSVVI 474
Cdd:COG5520 311 LDYGGGPNhggnskrgycmahFSKFVQNGYVRLDAT-----KSP--YGNVYVSAYVGPNKVVIVAINKGTYPVNQSFNFQ 383
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*.
gi 17539758 475 EG-GRRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIHTVIWK 519
Cdd:COG5520 384 NPdGSNVSSWVNSSTLNMAKTSNILAAGGRFNASLPAQSVTTFVWD 429
Glyco_hydro_30C pfam17189
Glycosyl hydrolase family 30 beta sandwich domain;
453-516 9.71e-07

Glycosyl hydrolase family 30 beta sandwich domain;


Pssm-ID: 319207  Cd Length: 63  Bit Score: 47.54  E-value: 9.71e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 17539758   453 GSTRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGfSIVLNLPPRSIHTV 516
Cdd:pfam17189   1 GAVRIGSSSSGSNNLEAVAFLNPDGSIVLVVLNRSDSDVTFTVKDGGQS-VFSLTLPARSIATF 63
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH