NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|167595913|gb|ABZ86089|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Bombinin super family cl05049
Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese ...
1-136 2.61e-79

Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese red belly toad). Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 have been found to be toxic to mice. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides.


The actual alignment was detected with superfamily member pfam05298:

Pssm-ID: 114046  Cd Length: 141  Bit Score: 230.25  E-value: 2.61e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167595913    1 MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLRGIRGIGGVLLSAGKAALKGLAKVLAEKYANGKRTAEDHEV 80
Cdd:pfam05298   1 MNFKYIVAVSFLIASAYARSEENDEQSLSQRDVLEEESLREIRGIGGKFLGGGKTAFKGGAKDLASHFANGKRTAEEHEV 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 167595913   81 MKRLEAVMRDLDSLDHPEEAFERETRGFNQDEIA-----KEKRISGPVLGLVGNALGGLIK 136
Cdd:pfam05298  81 MKRLEAVMRDLDSLDHPEEASERETRGFNQEEIAnlftkKEKRILGPVLSLVGNALGGLIK 141
 
Name Accession Description Interval E-value
Bombinin pfam05298
Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese ...
1-136 2.61e-79

Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese red belly toad). Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 have been found to be toxic to mice. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides.


Pssm-ID: 114046  Cd Length: 141  Bit Score: 230.25  E-value: 2.61e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167595913    1 MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLRGIRGIGGVLLSAGKAALKGLAKVLAEKYANGKRTAEDHEV 80
Cdd:pfam05298   1 MNFKYIVAVSFLIASAYARSEENDEQSLSQRDVLEEESLREIRGIGGKFLGGGKTAFKGGAKDLASHFANGKRTAEEHEV 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 167595913   81 MKRLEAVMRDLDSLDHPEEAFERETRGFNQDEIA-----KEKRISGPVLGLVGNALGGLIK 136
Cdd:pfam05298  81 MKRLEAVMRDLDSLDHPEEASERETRGFNQEEIAnlftkKEKRILGPVLSLVGNALGGLIK 141
 
Name Accession Description Interval E-value
Bombinin pfam05298
Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese ...
1-136 2.61e-79

Bombinin; This family consists of Bombinin and Maximin proteins from Bombina maxima (Chinese red belly toad). Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 have been found to be toxic to mice. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides.


Pssm-ID: 114046  Cd Length: 141  Bit Score: 230.25  E-value: 2.61e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167595913    1 MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLRGIRGIGGVLLSAGKAALKGLAKVLAEKYANGKRTAEDHEV 80
Cdd:pfam05298   1 MNFKYIVAVSFLIASAYARSEENDEQSLSQRDVLEEESLREIRGIGGKFLGGGKTAFKGGAKDLASHFANGKRTAEEHEV 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 167595913   81 MKRLEAVMRDLDSLDHPEEAFERETRGFNQDEIA-----KEKRISGPVLGLVGNALGGLIK 136
Cdd:pfam05298  81 MKRLEAVMRDLDSLDHPEEASERETRGFNQEEIAnlftkKEKRILGPVLSLVGNALGGLIK 141
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH