NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|163848205|ref|YP_001636249|]
View 

protein phosphatase 2C-like protein [Chloroflexus aurantiacus J-10-fl]

Protein Classification

DZR and PP2Cc domain-containing protein (domain architecture ID 12119922)

DZR and PP2Cc domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
161-415 1.51e-63

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


:

Pssm-ID: 223704  Cd Length: 262  Bit Score: 208.36  E-value: 1.51e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 161 EIAVRSHTGQVRSLNEDTVYAGRFSlgDEPLGYLLLVADGMGGAAAGEVASQLASETIKSFLQRELNTTLPTTDDDWLsl 240
Cdd:COG0631    9 KVAGLSDVGTVRKHNEDAFLIKPNE--NGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESLEELL-- 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 241 lRAAVQTAHRQIVAAAHSDPQRAGMGTTLTLALIIHRRAYIAHVGDSRAYLITPGTgdetpvWHQLTTDHTIVARLVDIG 320
Cdd:COG0631   85 -KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGE------LKQLTEDHSLVNRLEQRG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 321 QLSPEEARTHPQRHILYRSLGADQPLEIDTLVQPLATGDVLMLCSDGLFNHVTDEELAQmaIVHEPG---LAVSGLIDLA 397
Cdd:COG0631  158 IITPEEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVD--ILKNSEtpqEAADKLIELA 235
                        250
                 ....*....|....*...
gi 163848205 398 NQRGGSDNISIVLARFTG 415
Cdd:COG0631  236 LEGGGPDNITVVLVRLNG 253
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
124-147 5.93e-05

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


:

Pssm-ID: 315449  Cd Length: 45  Bit Score: 41.60  E-value: 5.93e-05
                          10        20
                  ....*....|....*....|....
gi 163848205  124 CPHCGRGNRAGARFCVSCGAALQP 147
Cdd:pfam12773   1 CPNCGHPNPPGAKFCPACGTPLPP 24
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
161-415 1.51e-63

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 208.36  E-value: 1.51e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 161 EIAVRSHTGQVRSLNEDTVYAGRFSlgDEPLGYLLLVADGMGGAAAGEVASQLASETIKSFLQRELNTTLPTTDDDWLsl 240
Cdd:COG0631    9 KVAGLSDVGTVRKHNEDAFLIKPNE--NGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESLEELL-- 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 241 lRAAVQTAHRQIVAAAHSDPQRAGMGTTLTLALIIHRRAYIAHVGDSRAYLITPGTgdetpvWHQLTTDHTIVARLVDIG 320
Cdd:COG0631   85 -KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGE------LKQLTEDHSLVNRLEQRG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 321 QLSPEEARTHPQRHILYRSLGADQPLEIDTLVQPLATGDVLMLCSDGLFNHVTDEELAQmaIVHEPG---LAVSGLIDLA 397
Cdd:COG0631  158 IITPEEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVD--ILKNSEtpqEAADKLIELA 235
                        250
                 ....*....|....*...
gi 163848205 398 NQRGGSDNISIVLARFTG 415
Cdd:COG0631  236 LEGGGPDNITVVLVRLNG 253
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
166-413 4.69e-45

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 159.03  E-value: 4.69e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 166 SHTGQVRSLNEDTVYAgRFSLGDEPLGYLLlvadgmggaaageV--------ASQLASETIKSFLQRELNTTLPTTDDDW 237
Cdd:cd00143    6 SDKGGDRKTNEDAVVI-KPNLNNEDGGLFG-------------VfdghgghaAGEFASKLLVEELLEELEETLTLSEEDI 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 238 LSLLRAAVQTAHRQIVAAAHSDPQRAGMGTTLTLALIIHRRAYIAHVGDSRAYLITPGTGdetpvwHQLTTDHTIV---- 313
Cdd:cd00143   72 EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEA------VQLTKDHKPVneee 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 314 -ARLVDIGQLSpeEARTHPQRHILYRSLGADQPLEIDTL------VQPLATGDVLMLCSDGLFNHVTDEELAQMA----I 382
Cdd:cd00143  146 rERIEKAGGRV--SNGRVPGVLAVTRALGDFDLKPGVSAepdvtvVKLTEDDDFLILASDGLWDVLSNQEAVDIVrselA 223
                        250       260       270
                 ....*....|....*....|....*....|.
gi 163848205 383 VHEPGLAVSGLIDLANQRGGSDNISIVLARF 413
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
210-410 1.11e-31

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.10  E-value: 1.11e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   210 ASQLASETIKSFLQRELNTTLpTTDDDWLSLLRAAVQTAHRQIVAAAHsdpqrAGMGTTLTLALIIHRRAYIAHVGDSRA 289
Cdd:smart00332  51 AAKFLSKNLPEILAEELIKEK-DELEDVEEALRKAFLSTDEEILEELE-----ALSGSTAVVALISGNKLYVANVGDSRA 124
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   290 YLITPGTGdetpvwHQLTTDHTiVARLVDIGQLSPEEARTHPQRHI----LYRSLGADQPLEI------DTLVQPLATGD 359
Cdd:smart00332 125 VLCRNGKA------VQLTEDHK-PSNEDERARIEAAGGFVINGRVNgvlaLSRAIGDFFLKPYvsaepdVTVVELTEKDD 197
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 163848205   360 VLMLCSDGLFNHVTDEELAQMA---IVHEPGLAVSGLIDLANQRGGSDNISIVL 410
Cdd:smart00332 198 FLILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDNITVVV 251
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
158-413 1.89e-23

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756  Cd Length: 645  Bit Score: 102.44  E-value: 1.89e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 158 LQAEIAVRSHTGQVRSLNED-----------------TVYA-GRFSLGDEPLGYlllvadgmggaAAGEVASQLASETIK 219
Cdd:PRK14559 373 VSLEDAGRTDVGRQRHHNEDyfgintriqklenphgrIVQArGLYILCDGMGGH-----------AAGEVASALAVETLQ 441
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 220 SFLQRELNTTLPTTDddwlsLLRAAVQTAHrQIVAAAHSDPQRAG---MGTTLTLALIIHRRAYIAHVGDSRAYLITPGT 296
Cdd:PRK14559 442 QYFQQHWQDELPDEE-----TIREAIYLAN-EAIYDLNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKG 515
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 297 GDEtpvwhQLTTDHTIVARLVDIGqLSPEEARTHPQRHILYRSLG-----ADQP----LEI--DTLvqplatgdvLMLCS 365
Cdd:PRK14559 516 GLE-----QLTVDHEVGQREIQRG-VEPQIAYARPDAYQLTQALGprdnsAIQPdiqfLEIeeDTL---------LLLCS 580
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 163848205 366 DGLfnhvTDEELAQmaiVH-----EPGL--------AVSGLIDLANQRGGSDNISIVLARF 413
Cdd:PRK14559 581 DGL----SDNDLLE---THwqthlLPLLsssanldqGLNKLIDLANQYNGHDNITAILVRL 634
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
210-406 2.25e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 72.38  E-value: 2.25e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  210 ASQLASETIKSFL--QRELNTtlpttDDDWLSLLRAAVQTAHRQIVAAAHSDPQRAGmgTTLTLALIIHRRAYIAHVGDS 287
Cdd:pfam00481  48 AAKYCGKHLHTILalRRSFLG-----LEKLEDALRKSFLEDTDEVLRSAEKEDLSSG--CTAVVALISGNKLYVANVGDS 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  288 RAYLITPGTGdetpvWHQLTTDHTI-----VARLVDIGQLSPEEARTHPQRHiLYRSLGADQPLEIDTLVQPLA------ 356
Cdd:pfam00481 121 RAVLCRNGNA-----IKRLTKDHKPsdedeRRRIRAAGGFVSRNGRVNGVLA-VSRAFGDFELKPGEQPVSAEPditsht 194
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 163848205  357 -TGD---VLMLCsDGLFNHVTDEELAQMAIVHE-----PGLAVSGLIDLANQRGGSDNI 406
Cdd:pfam00481 195 iTEDdefLILAC-DGLWDVLSDQEVVDLVRSELsdggsPMEAAEELRDEAIAYGSEDNI 252
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
124-147 5.93e-05

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 315449  Cd Length: 45  Bit Score: 41.60  E-value: 5.93e-05
                          10        20
                  ....*....|....*....|....
gi 163848205  124 CPHCGRGNRAGARFCVSCGAALQP 147
Cdd:pfam12773   1 CPNCGHPNPPGAKFCPACGTPLPP 24
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
161-415 1.51e-63

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 208.36  E-value: 1.51e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 161 EIAVRSHTGQVRSLNEDTVYAGRFSlgDEPLGYLLLVADGMGGAAAGEVASQLASETIKSFLQRELNTTLPTTDDDWLsl 240
Cdd:COG0631    9 KVAGLSDVGTVRKHNEDAFLIKPNE--NGNLLLLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNESLEELL-- 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 241 lRAAVQTAHRQIVAAAHSDPQRAGMGTTLTLALIIHRRAYIAHVGDSRAYLITPGTgdetpvWHQLTTDHTIVARLVDIG 320
Cdd:COG0631   85 -KEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGE------LKQLTEDHSLVNRLEQRG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 321 QLSPEEARTHPQRHILYRSLGADQPLEIDTLVQPLATGDVLMLCSDGLFNHVTDEELAQmaIVHEPG---LAVSGLIDLA 397
Cdd:COG0631  158 IITPEEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVD--ILKNSEtpqEAADKLIELA 235
                        250
                 ....*....|....*...
gi 163848205 398 NQRGGSDNISIVLARFTG 415
Cdd:COG0631  236 LEGGGPDNITVVLVRLNG 253
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
166-413 4.69e-45

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 159.03  E-value: 4.69e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 166 SHTGQVRSLNEDTVYAgRFSLGDEPLGYLLlvadgmggaaageV--------ASQLASETIKSFLQRELNTTLPTTDDDW 237
Cdd:cd00143    6 SDKGGDRKTNEDAVVI-KPNLNNEDGGLFG-------------VfdghgghaAGEFASKLLVEELLEELEETLTLSEEDI 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 238 LSLLRAAVQTAHRQIVAAAHSDPQRAGMGTTLTLALIIHRRAYIAHVGDSRAYLITPGTGdetpvwHQLTTDHTIV---- 313
Cdd:cd00143   72 EEALRKAFLRADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEA------VQLTKDHKPVneee 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 314 -ARLVDIGQLSpeEARTHPQRHILYRSLGADQPLEIDTL------VQPLATGDVLMLCSDGLFNHVTDEELAQMA----I 382
Cdd:cd00143  146 rERIEKAGGRV--SNGRVPGVLAVTRALGDFDLKPGVSAepdvtvVKLTEDDDFLILASDGLWDVLSNQEAVDIVrselA 223
                        250       260       270
                 ....*....|....*....|....*....|.
gi 163848205 383 VHEPGLAVSGLIDLANQRGGSDNISIVLARF 413
Cdd:cd00143  224 KEDLQEAAQELVDLALRRGSHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
210-410 1.11e-31

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.10  E-value: 1.11e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   210 ASQLASETIKSFLQRELNTTLpTTDDDWLSLLRAAVQTAHRQIVAAAHsdpqrAGMGTTLTLALIIHRRAYIAHVGDSRA 289
Cdd:smart00332  51 AAKFLSKNLPEILAEELIKEK-DELEDVEEALRKAFLSTDEEILEELE-----ALSGSTAVVALISGNKLYVANVGDSRA 124
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   290 YLITPGTGdetpvwHQLTTDHTiVARLVDIGQLSPEEARTHPQRHI----LYRSLGADQPLEI------DTLVQPLATGD 359
Cdd:smart00332 125 VLCRNGKA------VQLTEDHK-PSNEDERARIEAAGGFVINGRVNgvlaLSRAIGDFFLKPYvsaepdVTVVELTEKDD 197
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 163848205   360 VLMLCSDGLFNHVTDEELAQMA---IVHEPGLAVSGLIDLANQRGGSDNISIVL 410
Cdd:smart00332 198 FLILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALARGSKDNITVVV 251
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
158-413 1.89e-23

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756  Cd Length: 645  Bit Score: 102.44  E-value: 1.89e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 158 LQAEIAVRSHTGQVRSLNED-----------------TVYA-GRFSLGDEPLGYlllvadgmggaAAGEVASQLASETIK 219
Cdd:PRK14559 373 VSLEDAGRTDVGRQRHHNEDyfgintriqklenphgrIVQArGLYILCDGMGGH-----------AAGEVASALAVETLQ 441
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 220 SFLQRELNTTLPTTDddwlsLLRAAVQTAHrQIVAAAHSDPQRAG---MGTTLTLALIIHRRAYIAHVGDSRAYLITPGT 296
Cdd:PRK14559 442 QYFQQHWQDELPDEE-----TIREAIYLAN-EAIYDLNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVTRKG 515
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205 297 GDEtpvwhQLTTDHTIVARLVDIGqLSPEEARTHPQRHILYRSLG-----ADQP----LEI--DTLvqplatgdvLMLCS 365
Cdd:PRK14559 516 GLE-----QLTVDHEVGQREIQRG-VEPQIAYARPDAYQLTQALGprdnsAIQPdiqfLEIeeDTL---------LLLCS 580
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 163848205 366 DGLfnhvTDEELAQmaiVH-----EPGL--------AVSGLIDLANQRGGSDNISIVLARF 413
Cdd:PRK14559 581 DGL----SDNDLLE---THwqthlLPLLsssanldqGLNKLIDLANQYNGHDNITAILVRL 634
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
210-406 2.25e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 72.38  E-value: 2.25e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  210 ASQLASETIKSFL--QRELNTtlpttDDDWLSLLRAAVQTAHRQIVAAAHSDPQRAGmgTTLTLALIIHRRAYIAHVGDS 287
Cdd:pfam00481  48 AAKYCGKHLHTILalRRSFLG-----LEKLEDALRKSFLEDTDEVLRSAEKEDLSSG--CTAVVALISGNKLYVANVGDS 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  288 RAYLITPGTGdetpvWHQLTTDHTI-----VARLVDIGQLSPEEARTHPQRHiLYRSLGADQPLEIDTLVQPLA------ 356
Cdd:pfam00481 121 RAVLCRNGNA-----IKRLTKDHKPsdedeRRRIRAAGGFVSRNGRVNGVLA-VSRAFGDFELKPGEQPVSAEPditsht 194
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 163848205  357 -TGD---VLMLCsDGLFNHVTDEELAQMAIVHE-----PGLAVSGLIDLANQRGGSDNI 406
Cdd:pfam00481 195 iTEDdefLILAC-DGLWDVLSDQEVVDLVRSELsdggsPMEAAEELRDEAIAYGSEDNI 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
209-377 9.43e-09

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 54.66  E-value: 9.43e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   209 VASQLASETIKSFLQrelntTLPTTDDDWLSLLRAAVQTAHRQivaaahsdpQRAGMGTTLTLALI--IHRRAYIAHVGD 286
Cdd:smart00331  43 LAAALAMSMARSALR-----TLLSEGISLSQILERLNRAIYEN---------GEDGMFATLFLALYdfAGGTLSYANAGH 108
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205   287 SRAYLITPGTGDETPvwhqlttdhtivarLVDIGQLspeearthpqrhilyrsLGADQPLEIDTLVQPLATGDVLMLCSD 366
Cdd:smart00331 109 SPPYLLRADGGLVED--------------LDDLGAP-----------------LGLEPDVEVDVRELTLEPGDLLLLYTD 157
                          170
                   ....*....|.
gi 163848205   367 GLFNHVTDEEL 377
Cdd:smart00331 158 GLTEARNPERL 168
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
124-147 5.93e-05

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 315449  Cd Length: 45  Bit Score: 41.60  E-value: 5.93e-05
                          10        20
                  ....*....|....*....|....
gi 163848205  124 CPHCGRGNRAGARFCVSCGAALQP 147
Cdd:pfam12773   1 CPNCGHPNPPGAKFCPACGTPLPP 24
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
165-376 8.32e-05

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 316216  Cd Length: 209  Bit Score: 43.46  E-value: 8.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  165 RSHTgQVRSLNEDtvyagRFSLGDEPLGYLLLVADGMGGAAAGEVASQLASETIKSFLqRELNTTLPTTDDDWLSLLRAA 244
Cdd:pfam13672   3 TSHI-RRGLPCQD-----AFAVWVLDGGWLIAVADGAGSAKRSDVGARIAVEAAVEAL-ADLLESEEELIEALLRAILND 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  245 VQTAHRQIVAAAHSDPQRagMGTTLTLALIIHRRAYIAHVGDSRAYLITPGtGDetpvWHQLTTDHTivarlvdiGQLSP 324
Cdd:pfam13672  76 WLALVKAEALAQDLEPRD--YATTLLAAVVTPGGIVFFQIGDGAIVVRDRD-GE----VQVLSQPDS--------GEYAN 140
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 163848205  325 EearTHpqrhilyrSLGADQP---LEIDTLvqPLATGDVLMLCSDGLFNHVTDEE 376
Cdd:pfam13672 141 E---TT--------FLTSEDAldeLRIRRL--PLEPGDALALMTDGLANSLRDEE 182
zinc_ribbon_2 pfam13240
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
124-145 8.36e-05

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 315822  Cd Length: 23  Bit Score: 40.97  E-value: 8.36e-05
                          10        20
                  ....*....|....*....|..
gi 163848205  124 CPHCGRGNRAGARFCVSCGAAL 145
Cdd:pfam13240   2 CPNCGAENPDGAKFCPNCGAPL 23
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
340-413 7.45e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 40.31  E-value: 7.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163848205  340 LGADQPLEIDTLVQPLATGDVLMLCSDGLF-------NHVTDEELAQMAIVH---EPGLAVSGLIDLANQRGG---SDNI 406
Cdd:pfam07228 104 LGILPDADYEVVELELEPGDTLLLYTDGLTeardpdgELFGLERLLALLAERhglPPEELLDALLEALLRLGGgelEDDI 183

                  ....*..
gi 163848205  407 SIVLARF 413
Cdd:pfam07228 184 TLLVLRV 190
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
121-142 1.02e-03

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 315449  Cd Length: 45  Bit Score: 38.13  E-value: 1.02e-03
                          10        20
                  ....*....|....*....|..
gi 163848205  121 PLACPHCGRGNRAGARFCVSCG 142
Cdd:pfam12773  24 PVRCPNCGAPVDPNANFCPYCG 45
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH