NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|161484658|ref|NP_001104536|]
View 

peptidyl-prolyl cis-trans isomerase FKBP8 isoform a [Mus musculus]

Protein Classification

FKBP_C and TPR domain-containing protein (domain architecture ID 11991378)

FKBP_C and TPR domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
103-192 1.06e-20

FKBP-type peptidyl-prolyl cis-trans isomerase;


:

Pssm-ID: 306713  Cd Length: 94  Bit Score: 86.87  E-value: 1.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  103 GSSRPLKGQVVTVHLQMSLENGTRVQ----EEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPY 178
Cdd:pfam00254   1 GPEKAKKGDRVTVHYTGKLEDGTVFDssydRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGGV 80
                          90
                  ....*....|....
gi 161484658  179 IPPHAALCLEVTLK 192
Cdd:pfam00254  81 IPPNATLVFEVELL 94
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
206-329 9.53e-07

Tetratricopeptide (TPR) repeat [General function prediction only];


:

Pssm-ID: 223533  Cd Length: 291  Bit Score: 49.84  E-value: 9.53e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 206 QERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDmtceeeeelLQLKVKCLNNLAASQLKLDHYRAALRS 285
Cdd:COG0457  154 EKALELDPELNELAEALLALGALLEALGRYEEALELLEKALKLN---------PDDDAEALLNLGLLYLKLGKYEEALEY 224
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 161484658 286 CSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPS 329
Cdd:COG0457  225 YEKALELDPDNAEALYNLALLLLELGRYEEALEALEKALELDPD 268
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
103-192 1.06e-20

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 306713  Cd Length: 94  Bit Score: 86.87  E-value: 1.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  103 GSSRPLKGQVVTVHLQMSLENGTRVQ----EEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPY 178
Cdd:pfam00254   1 GPEKAKKGDRVTVHYTGKLEDGTVFDssydRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGGV 80
                          90
                  ....*....|....
gi 161484658  179 IPPHAALCLEVTLK 192
Cdd:pfam00254  81 IPPNATLVFEVELL 94
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
107-191 1.04e-08

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619  Cd Length: 205  Bit Score: 54.73  E-value: 1.04e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 107 PLKGQVVTVHLQMSLENGTRVQ-----EEPeLAFTLGDcdVIQALDLSVPLMDVGETAMVTADSKYCYGPQGsRSPYIPP 181
Cdd:COG0545  116 PKKGDTVTVHYTGTLIDGTVFDssydrGQP-AEFPLGG--VIPGWDEGLQGMKVGGKRKLTIPPELAYGERG-VPGVIPP 191
                         90
                 ....*....|
gi 161484658 182 HAALCLEVTL 191
Cdd:COG0545  192 NSTLVFEVEL 201
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
206-329 9.53e-07

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 49.84  E-value: 9.53e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 206 QERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDmtceeeeelLQLKVKCLNNLAASQLKLDHYRAALRS 285
Cdd:COG0457  154 EKALELDPELNELAEALLALGALLEALGRYEEALELLEKALKLN---------PDDDAEALLNLGLLYLKLGKYEEALEY 224
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 161484658 286 CSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPS 329
Cdd:COG0457  225 YEKALELDPDNAEALYNLALLLLELGRYEEALEALEKALELDPD 268
TPR_19 pfam14559
Tetratricopeptide repeat;
274-340 4.66e-05

Tetratricopeptide repeat;


Pssm-ID: 317020  Cd Length: 68  Bit Score: 42.21  E-value: 4.66e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 161484658  274 LKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKL 340
Cdd:pfam14559   2 LAEGDYDEALALLEQALQEDPDNADARLLLAEALLALGRLDEAEALLDALPEEDPDDPRYAALLAKL 68
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
266-343 6.53e-05

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 45.07  E-value: 6.53e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 161484658  266 LNNLAASQLKLDHYRAaLRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKK 343
Cdd:TIGR02917 807 LNNLAWLYLELKDPRA-LEYAERALKLAPNIPAILDTLGWLLVEKGEADRALPLLRKAVNIAPEAAAIRYHLALALLA 883
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
297-330 3.14e-04

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 39.35  E-value: 3.14e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 161484658   297 IKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:smart00028   1 AEALYNLGNAYLKLGDYDEALEYYEKALELDPNN 34
 
Name Accession Description Interval E-value
FKBP_C pfam00254
FKBP-type peptidyl-prolyl cis-trans isomerase;
103-192 1.06e-20

FKBP-type peptidyl-prolyl cis-trans isomerase;


Pssm-ID: 306713  Cd Length: 94  Bit Score: 86.87  E-value: 1.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  103 GSSRPLKGQVVTVHLQMSLENGTRVQ----EEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPY 178
Cdd:pfam00254   1 GPEKAKKGDRVTVHYTGKLEDGTVFDssydRGKPFEFTLGSGQVIPGWDEGLVGMKVGEKRKLTIPPELAYGEEGLAGGV 80
                          90
                  ....*....|....
gi 161484658  179 IPPHAALCLEVTLK 192
Cdd:pfam00254  81 IPPNATLVFEVELL 94
FkpA COG0545
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein ...
107-191 1.04e-08

FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223619  Cd Length: 205  Bit Score: 54.73  E-value: 1.04e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 107 PLKGQVVTVHLQMSLENGTRVQ-----EEPeLAFTLGDcdVIQALDLSVPLMDVGETAMVTADSKYCYGPQGsRSPYIPP 181
Cdd:COG0545  116 PKKGDTVTVHYTGTLIDGTVFDssydrGQP-AEFPLGG--VIPGWDEGLQGMKVGGKRKLTIPPELAYGERG-VPGVIPP 191
                         90
                 ....*....|
gi 161484658 182 HAALCLEVTL 191
Cdd:COG0545  192 NSTLVFEVEL 201
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
206-329 9.53e-07

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 49.84  E-value: 9.53e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 206 QERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDmtceeeeelLQLKVKCLNNLAASQLKLDHYRAALRS 285
Cdd:COG0457  154 EKALELDPELNELAEALLALGALLEALGRYEEALELLEKALKLN---------PDDDAEALLNLGLLYLKLGKYEEALEY 224
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 161484658 286 CSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPS 329
Cdd:COG0457  225 YEKALELDPDNAEALYNLALLLLELGRYEEALEALEKALELDPD 268
TPR_19 pfam14559
Tetratricopeptide repeat;
274-340 4.66e-05

Tetratricopeptide repeat;


Pssm-ID: 317020  Cd Length: 68  Bit Score: 42.21  E-value: 4.66e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 161484658  274 LKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKL 340
Cdd:pfam14559   2 LAEGDYDEALALLEQALQEDPDNADARLLLAEALLALGRLDEAEALLDALPEEDPDDPRYAALLAKL 68
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
266-343 6.53e-05

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 45.07  E-value: 6.53e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 161484658  266 LNNLAASQLKLDHYRAaLRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKK 343
Cdd:TIGR02917 807 LNNLAWLYLELKDPRA-LEYAERALKLAPNIPAILDTLGWLLVEKGEADRALPLLRKAVNIAPEAAAIRYHLALALLA 883
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
220-344 1.95e-04

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 42.91  E-value: 1.95e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 220 NAHYQRADFVLAANSYDLAIKAITSNTKvdmtceeeeellqlKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNI-K 298
Cdd:COG0457  138 GALYELGDYEEALELYEKALELDPELNE--------------LAEALLALGALLEALGRYEEALELLEKALKLNPDDDaE 203
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 161484658 299 ALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKR 344
Cdd:COG0457  204 ALLNLGLLYLKLGKYEEALEYYEKALELDPDNAEALYNLALLLLEL 249
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
190-367 3.05e-04

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273380  Cd Length: 615  Bit Score: 42.66  E-value: 3.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  190 TLKTAEDGPDLEM-----LSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAitsntKVDMTCeeeeellqlkvk 264
Cdd:TIGR00990 100 PVEPADELPEIDEssvanLSEEERKKYAAKLKEKGNKAYRNKDFNKAIKLYSKAIEC-----KPDPVY------------ 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  265 cLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRA-ALKLEPSNKTIHAELSKLVKK 343
Cdd:TIGR00990 163 -YSNRAACHNALGDWEKVVEDTTAALELDPDYSKALNRRANAYDGLGKYADALLDLTAsCIIDGFRNEQSAQAVERLLKK 241
                         170       180
                  ....*....|....*....|....
gi 161484658  344 RAaqrstETALYRKMLGNPSRLPA 367
Cdd:TIGR00990 242 FA-----ESKAKEILETKPENLPS 260
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
297-330 3.14e-04

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 39.35  E-value: 3.14e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 161484658   297 IKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:smart00028   1 AEALYNLGNAYLKLGDYDEALEYYEKALELDPNN 34
TPR_1 pfam00515
Tetratricopeptide repeat;
297-330 3.19e-04

Tetratricopeptide repeat;


Pssm-ID: 306905  Cd Length: 34  Bit Score: 39.33  E-value: 3.19e-04
                          10        20        30
                  ....*....|....*....|....*....|....
gi 161484658  297 IKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:pfam00515   1 AKALYNLGNAYFKLGKYDEALEYYEKALELNPNN 34
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
263-368 3.83e-04

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 42.38  E-value: 3.83e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  263 VKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKL---EPSNKTIHAELSK 339
Cdd:TIGR02917 193 VDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEAEKHADALLKKapnSPLAHYLKALVDF 272
                          90       100
                  ....*....|....*....|....*....
gi 161484658  340 LVKKRAAQRSTETALYRKmlgNPSRLPAK 368
Cdd:TIGR02917 273 QKKNYEDARETLQDALKS---APEYLPAL 298
TPR_2 pfam07719
Tetratricopeptide repeat; This Pfam entry includes outlying Tetratricopeptide-like repeats ...
298-330 4.60e-04

Tetratricopeptide repeat; This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by pfam00515.


Pssm-ID: 311588  Cd Length: 34  Bit Score: 38.67  E-value: 4.60e-04
                          10        20        30
                  ....*....|....*....|....*....|...
gi 161484658  298 KALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:pfam07719   2 EALYNLGLAYYKLGDYEEALEAYEKALELDPNN 34
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
210-359 4.92e-04

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 41.37  E-value: 4.92e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 210 ALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDmtceeeeeLLQLKVKCLNNLAASQLKLDHYRAALRSCSQV 289
Cdd:COG0457   14 ALAKLLAEALALLEAGLALLELLGELAEALELLEEALELL--------PNSDLAGLLLLLALALLKLGRLEEALELLEKA 85
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 161484658 290 LEHQ--PDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKML 359
Cdd:COG0457   86 LELEllPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLALGALYELGDYEEALELYEKAL 157
TPR_16 pfam13432
Tetratricopeptide repeat; This family is found predominantly at the C-terminus of ...
269-330 7.28e-04

Tetratricopeptide repeat; This family is found predominantly at the C-terminus of transglutaminase enzyme core regions.


Pssm-ID: 315995  Cd Length: 68  Bit Score: 38.49  E-value: 7.28e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 161484658  269 LAASQLKLDHYRAALRSCSQVLEHQ---PDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:pfam13432   3 LARAALRAGDYDDAAAALEAALARFpesPDAAEALLGLGLAALRQGRLAEAAAALRAALDAAPGD 67
TPR_11 pfam13414
TPR repeat;
304-343 8.23e-04

TPR repeat;


Pssm-ID: 315977  Cd Length: 42  Bit Score: 38.22  E-value: 8.23e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 161484658  304 GKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKK 343
Cdd:pfam13414   1 GDAYYEQGKYEEAIEAYKKALKLDPDNPEAYYNLGLAYYK 40
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
183-368 1.04e-03

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 40.60  E-value: 1.04e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 183 AALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDMTCEEEeellqlk 262
Cdd:COG0457   23 LALLEAGLALLELLGELAEALELLEEALELLPNSDLAGLLLLLALALLKLGRLEEALELLEKALELELLPNLA------- 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658 263 vKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGK-VLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLV 341
Cdd:COG0457   96 -EALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLALgALYELGDYEEALELYEKALELDPELNELAEALLALG 174
                        170       180
                 ....*....|....*....|....*....
gi 161484658 342 KKRAAQRSTETAL--YRKMLGNPSRLPAK 368
Cdd:COG0457  175 ALLEALGRYEEALelLEKALKLNPDDDAE 203
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
219-354 1.24e-03

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 40.84  E-value: 1.24e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161484658  219 GNAHYQRADFVLAANSYDLAIKAITSNtkvdmtceeeeellQLKVKclnnLAASQLKLDHYRAALRSCSQVLEHQPDNIK 298
Cdd:TIGR02917 710 GDLYLRQKDYPAAIQAYRKALKRAPSS--------------QNAIK----LHRALLASGNTAEAVKTLEAWLKTHPNDAV 771
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 161484658  299 ALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETAL 354
Cdd:TIGR02917 772 LRTALAELYLAQKDYDKAIKHYQTVVKKAPDNAVVLNNLAWLYLELKDPRALEYAE 827
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
269-330 4.09e-03

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 39.30  E-value: 4.09e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 161484658  269 LAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN 330
Cdd:TIGR02917 607 LGRAQLAAGDLNKAVSSFKKLLALQPDSALALLLLADAYAVMKNYAKAITSLKRALELKPDN 668
TPR smart00028
Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum ...
263-296 6.42e-03

Tetratricopeptide repeats; Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.


Pssm-ID: 197478  Cd Length: 34  Bit Score: 35.50  E-value: 6.42e-03
                           10        20        30
                   ....*....|....*....|....*....|....
gi 161484658   263 VKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDN 296
Cdd:smart00028   1 AEALYNLGNAYLKLGDYDEALEYYEKALELDPNN 34
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH