NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|161377427|ref|NP_001089168|]
View 

ornithine decarboxylase antizyme 2 [Xenopus laevis]

Protein Classification

ODC_AZ domain-containing protein (domain architecture ID 10489290)

ODC_AZ domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ODC_AZ pfam02100
Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme ...
95-179 3.21e-33

Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme proteins. The polyamine biosynthetic enzyme ornithine decarboxylase (ODC) is degraded by the 26 S proteasome via a ubiquitin-independent pathway. Its degradation is greatly accelerated by association with the polyamine-induced regulatory protein antizyme 1 (AZ1).


:

Pssm-ID: 307973  Cd Length: 93  Bit Score: 116.47  E-value: 3.21e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161377427   95 WSNQSLFVEIPEGELADGSKEGLLALLEFAEEKMEMNYVFICFRKSREDRG-SLLKTFSFLGFEIVRPGHPCVPPRPD-- 171
Cdd:pfam02100   5 GVERTLFVFFPEGVLGRGLKEGLVALLELAEEPLGCSHVVICFDRSRPDRAkSLVRTLGWVGFELVTLDHWAVPLDVTsd 84

                  ....*....
gi 161377427  172 -VMFMVYTL 179
Cdd:pfam02100  85 kWLFMGYEI 93
 
Name Accession Description Interval E-value
ODC_AZ pfam02100
Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme ...
95-179 3.21e-33

Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme proteins. The polyamine biosynthetic enzyme ornithine decarboxylase (ODC) is degraded by the 26 S proteasome via a ubiquitin-independent pathway. Its degradation is greatly accelerated by association with the polyamine-induced regulatory protein antizyme 1 (AZ1).


Pssm-ID: 307973  Cd Length: 93  Bit Score: 116.47  E-value: 3.21e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161377427   95 WSNQSLFVEIPEGELADGSKEGLLALLEFAEEKMEMNYVFICFRKSREDRG-SLLKTFSFLGFEIVRPGHPCVPPRPD-- 171
Cdd:pfam02100   5 GVERTLFVFFPEGVLGRGLKEGLVALLELAEEPLGCSHVVICFDRSRPDRAkSLVRTLGWVGFELVTLDHWAVPLDVTsd 84

                  ....*....
gi 161377427  172 -VMFMVYTL 179
Cdd:pfam02100  85 kWLFMGYEI 93
 
Name Accession Description Interval E-value
ODC_AZ pfam02100
Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme ...
95-179 3.21e-33

Ornithine decarboxylase antizyme; This family consists of ornithine decarboxylase antizyme proteins. The polyamine biosynthetic enzyme ornithine decarboxylase (ODC) is degraded by the 26 S proteasome via a ubiquitin-independent pathway. Its degradation is greatly accelerated by association with the polyamine-induced regulatory protein antizyme 1 (AZ1).


Pssm-ID: 307973  Cd Length: 93  Bit Score: 116.47  E-value: 3.21e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161377427   95 WSNQSLFVEIPEGELADGSKEGLLALLEFAEEKMEMNYVFICFRKSREDRG-SLLKTFSFLGFEIVRPGHPCVPPRPD-- 171
Cdd:pfam02100   5 GVERTLFVFFPEGVLGRGLKEGLVALLELAEEPLGCSHVVICFDRSRPDRAkSLVRTLGWVGFELVTLDHWAVPLDVTsd 84

                  ....*....
gi 161377427  172 -VMFMVYTL 179
Cdd:pfam02100  85 kWLFMGYEI 93
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH