NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|161353471|ref|NP_034384|]
View 

galanin receptor type 2 [Mus musculus]

Protein Classification

7tmA_Gal2_Gal3_R domain-containing protein (domain architecture ID 11606806)

7tmA_Gal2_Gal3_R domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
25-302 1.26e-169

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


:

Pssm-ID: 320225  Cd Length: 279  Bit Score: 478.55  E-value: 1.26e-169
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAV-STTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFL 103
Cdd:cd15097    1 VIVPVVFSLIFLLGTVGNSLVLAVLLRSGQSGhNTTNLFILNLSVADLCFILFCVPFQATIYSLEGWVFGSFLCKAVHFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRR 183
Cdd:cd15097   81 IYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPRNAVAAIALIWGLSLLFAGPYLSYYDLIDYANSTVCMPGWEEARR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRF 263
Cdd:cd15097  161 KAMDTCTFAFGYLIPVLVVSLSYTRTIKYLWTAVDPLEAMSESKRAKRKVTKMIIIVTALFCLCWLPHHVVILCYLYGDF 240
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 161353471 264 PLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15097  241 PFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGF 279
 
Name Accession Description Interval E-value
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
25-302 1.26e-169

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320225  Cd Length: 279  Bit Score: 478.55  E-value: 1.26e-169
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAV-STTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFL 103
Cdd:cd15097    1 VIVPVVFSLIFLLGTVGNSLVLAVLLRSGQSGhNTTNLFILNLSVADLCFILFCVPFQATIYSLEGWVFGSFLCKAVHFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRR 183
Cdd:cd15097   81 IYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPRNAVAAIALIWGLSLLFAGPYLSYYDLIDYANSTVCMPGWEEARR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRF 263
Cdd:cd15097  161 KAMDTCTFAFGYLIPVLVVSLSYTRTIKYLWTAVDPLEAMSESKRAKRKVTKMIIIVTALFCLCWLPHHVVILCYLYGDF 240
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 161353471 264 PLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15097  241 PFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGF 279
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
41-291 4.10e-57

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 189.83  E-value: 4.10e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471   41 GNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL 120
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  121 DRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLAN--LTVCHPAWSAP-RRRAMDLCTFVFSYLL 197
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSngVTSCLITFPESlWPVSYLLFSTVVGFLL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  198 PVLVLSLTYARTLHYLWRTVDPVAAgsgSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRAT-----YAL 272
Cdd:pfam00001 159 PLLVILVCYTRIIRTLRKQARSRRR---SVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCvvtppRTL 235
                         250
                  ....*....|....*....
gi 161353471  273 RILSHLVSYANSCVNPIVY 291
Cdd:pfam00001 236 LQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
31-304 4.71e-33

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 127.20  E-value: 4.71e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  31 FALIFLVGAVGNALVLAVLLRGgQAVSTTNLFILNLGVADLCFILCcVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHA 110
Cdd:PHA03087  47 YSTIFFFGLVGNIIVIYVLTKT-KIKTPMDIYLLNLAVSDLLFVMT-LPFQIYYYILFQWSFGEFACKIVSGLYYIGFYN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 111 SSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAprrRAMDLCT 190
Cdd:PHA03087 125 SMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNN---KTMNWKL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 191 FV------FSYLLPVLVLSLTYARTLHYLwrtvdpvaAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHAL-------ILC 257
Cdd:PHA03087 202 FInfeiniIGMLIPLTILLYCYSKILITL--------KGINKSKKNKKAIKLVLIIVILFVIFWLPFNVSvfvyslhILH 273
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 161353471 258 VWFGRFPLTRATYALRIlSHLVSYANSCVNPIVYALVSKHFRKGFRK 304
Cdd:PHA03087 274 FKSGCKAVKYIQYALHV-TEIISLSHCCINPLIYAFVSEFFNKHKKK 319
 
Name Accession Description Interval E-value
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
25-302 1.26e-169

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320225  Cd Length: 279  Bit Score: 478.55  E-value: 1.26e-169
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAV-STTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFL 103
Cdd:cd15097    1 VIVPVVFSLIFLLGTVGNSLVLAVLLRSGQSGhNTTNLFILNLSVADLCFILFCVPFQATIYSLEGWVFGSFLCKAVHFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRR 183
Cdd:cd15097   81 IYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPRNAVAAIALIWGLSLLFAGPYLSYYDLIDYANSTVCMPGWEEARR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRF 263
Cdd:cd15097  161 KAMDTCTFAFGYLIPVLVVSLSYTRTIKYLWTAVDPLEAMSESKRAKRKVTKMIIIVTALFCLCWLPHHVVILCYLYGDF 240
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 161353471 264 PLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15097  241 PFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGF 279
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
25-302 6.35e-140

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102  Cd Length: 281  Bit Score: 403.39  E-value: 6.35e-140
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd14971    1 WIVPLFFALIFLLGLVGNSLVILVVARNKPMRSTTNLFILNLAVADLTFLLFCVPFTATIYPLPGWVFGDFMCKFVHYFQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQ--LANLTVCHPAW-SAP 181
Cdd:cd14971   81 QVSMHASIFTLVAMSLDRFLAVVYPLRSLHIRTPRNALAASGCIWVVSLAVAAPVLALHRLRNytPGNRTVCSEAWpSRA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 182 RRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFG 261
Cdd:cd14971  161 HRRAFALCTFLFGYLLPLLLICVCYAAMLRHLWRVAVRPVLSEGSRRAKRKVTRLVLVVVVLFAACWGPIHAILLLVALG 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 161353471 262 RFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14971  241 PFPLTYATYALRIWAHCLAYSNSAVNPVLYAFLSEHFRKAF 281
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
25-302 1.26e-107

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226  Cd Length: 282  Bit Score: 320.91  E-value: 1.26e-107
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRG--GQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHF 102
Cdd:cd15098    1 VIVPVVFGLIFCLGVLGNSLVITVLARVkpGKRRSTTNVFILNLSIADLFFLLFCVPFQATIYSLPEWVFGAFMCKFVHY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 103 LIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQ---SQLANLTVCHPAWS 179
Cdd:cd15098   81 FFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSLRTRRNALLGVLVIWVLSLAMASPVAVHQDLvhhWTASNQTFCWENWP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 180 APR-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTvdPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCV 258
Cdd:cd15098  161 EKQqKPVYVVCTFVFGYLLPLLLITFCYAKVLNHLHKK--LKNMSKKSERSKKKTAQTVLVVVVVFGISWLPHHIIHLWV 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 161353471 259 WFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15098  239 EFGDFPLTQASFVLRITAHCLAYANSCVNPIIYAFLSENFRKAY 282
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
25-302 1.09e-86

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223  Cd Length: 288  Bit Score: 267.61  E-value: 1.09e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15095    1 WLVPLIFAIIFLVGLAGNSLVIYVVSRHREMRTVTNYYIVNLAVTDLAFLVCCVPFTAALYATPSWVFGDFMCKFVNYMM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLA---NLTVCHPAWSAP 181
Cdd:cd15095   81 QVTVQATCLTLTALSVDRYYAIVHPIRSLRFRTPRVAVVVSACIWIVSFLLSIPVAIYYRLEEGYwygPQTYCREVWPSK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 182 R-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRT--VDPVAAGSGSQRA---KRKVTRMIVIVAVLFCLCWMPHHALI 255
Cdd:cd15095  161 AfQKAYMIYTVLLTYVIPLAIIAVCYGLILRRLWRRsvDGNNQSEQLSERAlrqKRKVTRMVIVVVVLFAICWLPNHVLN 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 161353471 256 LC-VWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15095  241 LWqRFDPNFPETYATYALKIAALCLSYANSAVNPFVYAFMGENFRKYF 288
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
25-302 2.35e-83

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224  Cd Length: 284  Bit Score: 258.76  E-value: 2.35e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15096    1 IVVPVIFGLIFIVGLIGNSLVILVVLSNQQMRSTTNILILNLAVADLLFVVFCVPFTATDYVLPTWPFGDVWCKIVQYLV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGP----YLSYYSQSQLANLTVCHPAWSA 180
Cdd:cd15096   81 YVTAYASVYTLVLMSLDRYLAVVHPITSMSIRTERNTLIAIVGIWIVILVANIPvlflHGVVSYGFSSEAYSYCTFLTEV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 181 PRR-RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSG-SQRAKRKVTRMIVIVAVLFCLCWMPHHALILCV 258
Cdd:cd15096  161 GTAaQTFFTSFFLFSYLIPLTLICVLYMLMLRRLRRQKSPGGRRSAeSQRGKRRVTRLVVVVVVVFAICWLPIHIILLLK 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 161353471 259 WFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15096  241 YYGVLPETVLYVVIQILSNCLAYGNSCVNPILYAFLSQNFRKAF 284
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
29-295 4.07e-71

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 226.77  E-value: 4.07e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd00637    3 VLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTVSL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPR-RRAMD 187
Cdd:cd00637   83 TASILTLTAISVDRYLAIVHPLRYRRRFTKRRAKLVIALIWLLSLLLALPPLLGWKVYEYGGYCCCCLCWPDLTlSKAYT 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 188 LCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQ-----RAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGR 262
Cdd:cd00637  163 IFLFVLLFLLPLLVIIVCYVRIFRKLRRHRKRISSSSNSSrrrrrRRERKVTKMLLIVVVVFLLCWLPYFILFLLDVFGP 242
                        250       260       270
                 ....*....|....*....|....*....|...
gi 161353471 263 FPlTRATYALRILSHLVSYANSCVNPIVYALVS 295
Cdd:cd00637  243 DP-SPLPRILYFLALLLAYLNSAINPIIYAFFN 274
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
29-302 6.37e-71

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 227.10  E-value: 6.37e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd14993    5 VLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVSLFCMPLTLLENVYRPWVFGEVLCKAVPYLQGVSV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANL-------TVCHPAWSAP 181
Cdd:cd14993   85 SASVLTLVAISIDRYLAICYPLKARRVSTKRRARIIIVAIWVIAIIIMLPLLVVYELEEIISSepgtitiYICTEDWPSP 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 182 R-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQ-------RAKRKVTRMIVIVAVLFCLCWMPHHA 253
Cdd:cd14993  165 ElRKAYNVALFVVLYVLPLLIISVAYSLIGRRLWRRKPPGDRGSANStssrrilRSKKKVARMLIVVVVLFALSWLPYYV 244
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 161353471 254 LILCVWFGRFPLTRATYALRI---LSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14993  245 LSILLDFGPLSSEESDENFLLilpFAQLLGYSNSAINPIIYCFMSKKFRRGF 296
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
25-302 4.41e-65

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 211.38  E-value: 4.41e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFiLCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd14970    1 IVIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELF-LLGLPFLATSYLLGYWPFGEVMCKIVLSVD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYS-QSQLANLTVCHPAWSAPRR 183
Cdd:cd14970   80 AYNMFTSIFCLTVMSVDRYLAVVHPVKSLRFRTPRKAKLVSLCVWALSLVLGLPVIIFARtLQEEGGTISCNLQWPDPPD 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 ---RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGS-QRAKRKVTRMIVIVAVLFCLCWMPHHALILCVW 259
Cdd:cd14970  160 ywgRVFTIYTFVLGFAVPLLVITVCYSLIIRRLRSSRNLSTSGAREkRRARRKVTRLVLVVVAVFVVCWLPFHVFQIVRL 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 161353471 260 FGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14970  240 LIDPPETLTVVGVFLFCIALSYANSCLNPILYAFLDENFRKSF 282
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
29-295 1.55e-64

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 209.57  E-value: 1.55e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd14964    3 VLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALADLLFSLVVVPFLLLGLLSGEWSFGFAGCKLVLFFFYLFG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQL---ANLTVCHPAWSAPRRRA 185
Cdd:cd14964   83 FASIFLLTAMAIDRYLAICHPLKYTVLMTPRRARLLILGIWVLSLLLSLPPLLGWGTLPFcgpNVPLLTLSCSDTAWNIA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 186 MDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPL 265
Cdd:cd14964  163 YTLGLLILGFLLPLLLILVSYARIVRALLRRKRITRSAISSARRERKAFKTLLIVVLVFLLCWLPYHIVYLLPALLQLSN 242
                        250       260       270
                 ....*....|....*....|....*....|
gi 161353471 266 TraTYALRILSHLVSYANSCVNPIVYALVS 295
Cdd:cd14964  243 S--LPLLLLLSVLLAVLNSCLNPLIYSLRN 270
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
25-302 1.35e-58

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335  Cd Length: 291  Bit Score: 194.76  E-value: 1.35e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFqatiyTLDD-----WVFGSLLCKA 99
Cdd:cd15207    1 VLFIVSYSLIFLLCVVGNVLVCLVVAKNPRMRTVTNYFILNLAVSDLLVGVFCMPF-----TLVDniltgWPFGDVMCKL 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 100 VHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYL-----SYYSQSQLANLTVC 174
Cdd:cd15207   76 SPLVQGVSVAASVFTLVAIAVDRYRAVVHPTEPK--LTNRQAFVIIVAIWVLALAIMIPQAlvlevKEYQFFRGQTVHIC 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 175 HPAWSAPR-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRA------KRKVTRMIVIVAVLFCLC 247
Cdd:cd15207  154 VEFWPSDEyRKAYTTSLFVLCYVAPLLIIAVLYVRIGYRLWFKPVPGGGSASREAQaavskkKVRVIKMLIVVVVLFALS 233
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 161353471 248 WMPHHALILCVWFGRFPLTRAT----YALRIlSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15207  234 WLPLHTVTMLDDFGNLSPNQREvlyvYIYPI-AHWLAYFNSCVNPIVYGYFNRNFRKGF 291
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
41-291 4.10e-57

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 189.83  E-value: 4.10e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471   41 GNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL 120
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  121 DRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLAN--LTVCHPAWSAP-RRRAMDLCTFVFSYLL 197
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSngVTSCLITFPESlWPVSYLLFSTVVGFLL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  198 PVLVLSLTYARTLHYLWRTVDPVAAgsgSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRAT-----YAL 272
Cdd:pfam00001 159 PLLVILVCYTRIIRTLRKQARSRRR---SVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCvvtppRTL 235
                         250
                  ....*....|....*....
gi 161353471  273 RILSHLVSYANSCVNPIVY 291
Cdd:pfam00001 236 LQLTVWLAYSNSCLNPIIY 254
7tmA_Bombesin_R-like cd15927
bombesin receptor subfamily, member of the class A family of seven-transmembrane G ...
25-302 5.31e-57

bombesin receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This bombesin subfamily of G-protein coupled receptors consists of neuromedin B receptor (NMBR), gastrin-releasing peptide receptor (GRPR), and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple mainly to the G proteins of G(q/11) family. NMBR functions as the receptor for the neuropeptide neuromedin B, a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. Gastrin-releasing peptide is an endogenous ligand for GRPR and shares high sequence homology with NMB in the C-terminal region. Both NMB and GRP possess bombesin-like biochemical properties. BRS-3 is classified as an orphan receptor and suggested to play a role in sperm cell division and maturation. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. The bombesin receptor family belongs to the seven transmembrane rhodopsin-like G-protein coupled receptors (class A GPCRs), which perceive extracellular signals and transduce them to guanine nucleotide-binding (G) proteins.


Pssm-ID: 320593  Cd Length: 294  Bit Score: 190.56  E-value: 5.31e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15927    1 YVVPILFALIFLVGVLGNGTLILIFLRNKSMRNVPNIFILSLALGDLLLLLTCVPFTSTIYTLDSWPFGEFLCKLSEFLK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQL-----ANLTVCHP--- 176
Cdd:cd15927   81 DTSIGVSVFTLTALSADRYFAIVNPMRKHRSQATRRTLVTAASIWIVSILLAIPEAIFSHVVTFtltdnQTIQICYPypq 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 177 AWSAPRRRAMDLCTFVFSYLLPVLVLSLTY---ARTLHYLWRTVDPVaAGSGSQR---AKRKVTRMIVIVAVLFCLCWMP 250
Cdd:cd15927  161 ELGPNYPKIMVLLRFLVYYLIPLLIIGVFYvlmARHLIRSTRNIGSG-QNQAAQRqieARKKVAKTVLAFVVLFAVCWLP 239
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 161353471 251 HHALILCVWF---GRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15927  240 RHVFMLWFHFapnGLVDYNAFWHVLKIVGFCLSFINSCVNPVALYLLSGSFRRHF 294
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
29-302 1.69e-56

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132  Cd Length: 266  Bit Score: 188.64  E-value: 1.69e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd15001    4 IVYVITFVLGLIGNSLVIFVVARFRRMRSVTNVFLASLATADLLLLVFCVPLKTAEYFSPTWSLGAFLCKAVAYLQLLSF 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGP------YLSYYSQSQLANLTVCHPAWSAPR 182
Cdd:cd15001   84 ICSVLTLTAISIERYYVILHPMKAKSFCTIGRARKVALLIWILSAILASPvlfgqgLVRYESENGVTVYHCQKAWPSTLY 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 183 RRAMDLCTFVFSYLLPVLVLSLTYARtlhylwrtvdpvaagsgsqRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGR 262
Cdd:cd15001  164 SRLYVVYLAIVIFFIPLIVMTFAYAR-------------------DTRKQVIKMLISVVVLFAVCWGPLLIDNLLVSFDV 224
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 161353471 263 FPL--TRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15001  225 ISTlhTQALKYMRIAFHLLSYANSCINPIIYAFMSKNFRSSF 266
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
29-302 1.94e-55

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331  Cd Length: 293  Bit Score: 186.66  E-value: 1.94e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLcfILC--CVPFQATIYTLDDWVFGSLLCKAVHFLIFL 106
Cdd:cd15203    5 LLYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSDL--LLClvSLPFTLIYTLTKNWPFGSILCKLVPSLQGV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 107 TMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLA------NLTVCHPAWSA 180
Cdd:cd15203   83 SIFVSTLTLTAIAIDRYQLIVYPTRPR--MSKRHALLIIALIWILSLLLSLPLAIFQELSDVPieilpyCGYFCTESWPS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 181 PR-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYL---WRTVDPVAAGSGSQRA-----KRKVTRMIVIVAVLFCLCWMPH 251
Cdd:cd15203  161 SSsRLIYTISVLVLQFVIPLLIISFCYFRISLKLrkrVKKKRGKRTLSSRRRRselrrKRRTNRLLIAMVVVFAVCWLPL 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 161353471 252 HAL-ILCVWFGRFPL-TRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15203  241 NLFnLLRDFEPLPQIdGRHFYLIFLICHLIAMSSACVNPLLYGWLNDNFRKEF 293
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
29-302 1.57e-52

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 177.76  E-value: 1.57e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd14967    4 VFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLGYWPFGPVLCRFWIALDVLCC 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSG-PYLSYYSQSQLANLTVCHPAWSAprrRAMD 187
Cdd:cd14967   84 TASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLISLpPLVGWRDETQPSVVDCECEFTPN---KIYV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 188 LCTFVFSYLLPVLVLSLTYARTLHYLwrtvdpvaagsgsqRAKRKVTRMIVIVAVLFCLCWMPHHALILC-VWFGRFPLT 266
Cdd:cd14967  161 LVSSVISFFIPLLIMIVLYARIFRVA--------------RRELKAAKTLAIIVGAFLLCWLPFFIIYLVsAFCPPDCVP 226
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 161353471 267 RATYAlriLSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14967  227 PILYA---VFFWLGYLNSALNPIIYALFNRDFRRAF 259
7tmA_ETH-R cd14997
ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G ...
25-302 6.43e-52

ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the ecdysis-triggering hormone receptors found in insects, which are members of the class A family of seven-transmembrane G-protein coupled receptors. Ecdysis-triggering hormones are vital regulatory signals that govern the stereotypic physiological sequence leading to cuticle shedding in insects. Thus, the ETH signaling system has been a target for the design of more sophisticated insect-selective pest control strategies. Two subtypes of ecdysis-triggering hormone receptor were identified in Drosophila melanogaster. Blood-borne ecdysis-triggering hormone (ETH) activates the behavioral sequence through direct actions on the central nervous system. In insects, ecdysis is thought to be controlled by the interaction between peptide hormones; in particular between ecdysis-triggering hormone (ETH) from the periphery and eclosion hormone (EH) and crustacean cardioactive peptide (CCAP) from the central nervous system. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320128  Cd Length: 294  Bit Score: 177.48  E-value: 6.43e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQAT-IYTLDDWVFGSLLCKAVHFL 103
Cdd:cd14997    1 VLVSVVYGVIFVVGVLGNVLVGIVVWKNKDMRTPTNIFLVNLSVADLLVLLVCMPVALVeTWAREPWLLGEFMCKLVPFV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSY--YSQSQLAN---LTVCHPAW 178
Cdd:cd14997   81 ELTVAHASVLTILAISFERYYAICHPLQAKYVCTKRRALVIIALIWLLALLTSSPVLFIteFKEEDFNDgtpVAVCRTPA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 179 SAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGS-----GSQRAKRKVTRMIVIVAVLFCLCWMPHHA 253
Cdd:cd14997  161 DTFWKVAYILSTIVVFFVVPLAILSGLYSVICRRLVGHPALESRRAdaanrHTLRSRRQVVYMLITVVVLFFVCLLPFRV 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 161353471 254 LILCVWF---------GRFPLTRATYALRILshlvSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14997  241 VTLWIIFapdedlqalGLEGYLNLLVFCRVM----VYLNSALNPILYNLMSTKFRSAF 294
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
25-302 7.21e-52

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221  Cd Length: 280  Bit Score: 176.88  E-value: 7.21e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCcVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15093    1 VLIPCIYAVVCLVGLCGNSLVIYVVLRYAKMKTVTNIYILNLAIADELFMLG-LPFLAASNALRHWPFGSVLCRLVLSVD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYY-SQSQLANLTVCHPAWSAPRR 183
Cdd:cd15093   80 GINMFTSIFCLTVMSVDRYLAVVHPIKSARWRRPRVAKVVNLAVWVASLLVILPVVVFAgTRENQDGSSACNMQWPEPAA 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 R---AMDLCTFVFSYLLPVLVLSLTYArtlhYLWRTVDPVAAGSGSQ---RAKRKVTRMIVIVAVLFCLCWMPHHALILC 257
Cdd:cd15093  160 AwsaGFIIYTFVLGFLLPLLIICLCYL----LIVIKVKSAGLRAGWQqrkRSERKVTRMVVMVVVVFVICWLPFYVLQLV 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 161353471 258 VWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15093  236 NVFVQLPETPALVGVYHFVVILSYANSCANPILYGFLSDNFKKSF 280
7tmA_OXR cd15208
orexin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
31-302 2.53e-51

orexin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Orexins (OXs, also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. Thus, activation of OX1R or OX2R will activate phospholipase activity and the phosphatidylinositol and calcium signaling pathways. Additionally, OX2R activation can also lead to inhibition of adenylate cyclase.


Pssm-ID: 320336  Cd Length: 303  Bit Score: 176.04  E-value: 2.53e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  31 FALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHA 110
Cdd:cd15208    7 YILVFIVGLVGNVLVCFAVWRNHHMRTVTNYFIVNLSLADFLVIIICLPATLLVDVTETWFFGQVLCKIIPYLQTVSVSV 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 111 SSFTLAAVSLDRYLAIRYPLHSRElrTPRNALAAIGLIWGLALLFSGPYLSYY---SQSQLAN----LTVCHPAWSAPRR 183
Cdd:cd15208   87 SVLTLSCIALDRWYAICHPLMFKS--TAKRARVSILIIWIVSLLIMIPQAIVMecsRVVPLANktilLTVCDERWSDSIY 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 RAM-DLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDP-----------------VAAGSGSQRAKRKVTRMIVIVAVLFC 245
Cdd:cd15208  165 QKVyHICFFLVTYLLPLCLMILAYFQIFRKLWCRQIPgtssvvqrkwnkprksaVAAEEKQLRSRRKTAKMLIVVVIMFA 244
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 161353471 246 LCWMPHHAL-ILCVWFGRFPLTRAT-YALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15208  245 ICYLPVHLLnILRYVFGLFTVDRETiYAWFLFSHWLVYANSAINPIIYNFMSGKFREEF 303
7tmA_TACR-like cd15202
tachykinin receptors and related receptors, member of the class A family of ...
25-302 2.05e-50

tachykinin receptors and related receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the neurokinin/tachykinin receptors and its closely related receptors such as orphan GPR83 and leucokinin-like peptide receptor. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320330  Cd Length: 288  Bit Score: 173.08  E-value: 2.05e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15202    1 VLLIVAYSFIIVFSLFGNVLVCWIIFKNQRMRTVTNYFIVNLAVADIMITLFNTPFTFVRAVNNTWIFGLFMCHFSNFAQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGP---YLSYYSQSQLANLT--VCHPAWS 179
Cdd:cd15202   81 YCSVHVSAYTLTAIAVDRYQAIMHPLKPR--ISKTKAKFIIAVIWTLALAFALPhaiCSKLETFKYSEDIVrsLCLEDWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 180 APRR---RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGS----GSQRAKRKVTRMIVIVAVLFCLCWMPHH 252
Cdd:cd15202  159 ERADlfwKYYDLALFILQYFLPLLVISFAYARVGIKLWASNMPGDATTeryfALRRKKKKVIKMLMVVVVLFALCWLPFN 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 161353471 253 ALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15202  239 IYVLLLSSKPDYLIKTINAVYFAFHWLAMSSTCYNPFIYCWLNERFRIEF 288
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
25-300 4.79e-50

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 172.06  E-value: 4.79e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCcVPFQATIY-TLDDWVFGSLLCKAVHFL 103
Cdd:cd14982    1 TLFPIVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLT-LPFRIYYYlNGGWWPFGDFLCRLTGLL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGP-YLSYYSQSQLANLTVCHPAWSAPR 182
Cdd:cd14982   80 FYINMYGSILFLTCISVDRYLAVVHPLKSRRLRRKRYAVGVCAGVWILVLAASVPlLLLRSTIAKENNSTTCFEFLSEWL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 183 RRA--MDLCTFVFSYLLPVLVLSLTYARTLHYLWRTvdpvAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHA--LILCV 258
Cdd:cd14982  160 ASAapLVLIALVVGFLIPLLIILVCYSLIIRALRRR----SKQSQKSVRKRKALRMILIVLAVFLVCFLPYHVtrILYLL 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 161353471 259 WFGRFPL----TRATYALRILSHLVSYANSCVNPIVYALVSKHFRK 300
Cdd:cd14982  236 VRLSVIAdcsaRNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFRK 281
7tmA_TACR cd15390
neurokinin receptors (or tachykinin receptors), member of the class A family of ...
25-302 1.14e-49

neurokinin receptors (or tachykinin receptors), member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320512  Cd Length: 289  Bit Score: 171.32  E-value: 1.14e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15390    1 VLWSIVFVVMVLVAIGGNLIVIWIVLAHKRMRTVTNYFLVNLAVADLLISAFNTVFNFTYLLYNDWPFGLFYCKFSNFVA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSY-----YSQSQLANLTVCHPAWS 179
Cdd:cd15390   81 ITTVAASVFTLMAISIDRYIAIVHPLRPR--LSRRTTKIAIAVIWLASFLLALPQLLYsttetYYYYTGSERTVCFIAWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 180 APRRRAMD----LCTFVFSYLLPVLVLSLTYARTLHYLWRT---VDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHH 252
Cdd:cd15390  159 DGPNSLQDfvynIVLFVVTYFLPLIIMAVAYTRVGVELWGSktiGENTPRQLESVRAKRKVVKMMIVVVVIFAICWLPYH 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 161353471 253 ALILCVWFgRFPLTRATYALRIlsHLVSY----ANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15390  239 LYFILTYL-YPDINSWKYIQQI--YLAIYwlamSNSMYNPIIYCWMNKRFRYGF 289
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
25-300 2.68e-49

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216  Cd Length: 278  Bit Score: 169.94  E-value: 2.68e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCcVPFQATIYTLD-DWVFGSLLCKAVHFL 103
Cdd:cd15088    1 VIMPSVFGCICVVGLVGNGIVLYVLVRCSKLRTAPDIFIFNLAVADLLFMLG-MPFLIHQFAIDgQWYFGEVMCKIITAL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLAN-LTVCHPAWSAPR 182
Cdd:cd15088   80 DANNQFTSTYILTAMSVDRYLAVVHPIRSTKYRTRFVAKLVNVGLWAASFLSILPVWVYSSLIYFPDgTTFCYVSLPSPD 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 183 R-RAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRkVTRMIVIVAVLFCLCWMPHHALILCvwfg 261
Cdd:cd15088  160 DlYWFTIYHFILGFAVPLVVITVCYILILHRLARGVAPGNQSHGSSRTKR-VTKMVILIVVVFIVCWLPFHVVQLV---- 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 161353471 262 RFPLTRATYALRI---LSHLVSYANSCVNPIVYALVSKHFRK 300
Cdd:cd15088  235 NLAMNRPTLAFEVayfLSICLGYANSCLNPFVYILVSENFRK 276
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
25-302 3.72e-49

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 169.32  E-value: 3.72e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFiLCCVPFQAtIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd14984    1 VFLPVLYSLVFVLGLVGNSLVLLVLLYYKKLRSMTDVYLLNLALSDLLF-VLTLPFWA-VYAAHGWVFGSFLCKLVSALY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPR-- 182
Cdd:cd14984   79 TINFYSGILFLACISIDRYLAIVHAVSALRARTLLHGKLTCLAVWALALLLSLPEFIFSQVYEENGSSRCSYIYPEDTat 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 183 --RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRtvdpvaagsGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWF 260
Cdd:cd14984  159 twKTLLRLLQNILGFLLPLLVMLFCYSRIIRTLLR---------ARNHKKHRALRLIFAVVVVFFLCWLPYNIVLLLDTL 229
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 161353471 261 GRFPL--------TRATYALRILSHLvSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14984  230 QRLGViirscelsKRLDYALQVTETL-AFSHCCLNPVLYAFVGEKFRKYL 278
7tmA_GPR151 cd15002
G protein-coupled receptor 151, member of the class A family of seven-transmembrane G ...
26-302 4.06e-49

G protein-coupled receptor 151, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 151 (GRP151) is an orphan receptor of unknown function. Its expression is conserved in habenular axonal projections of vertebrates and may be a promising novel target for psychiatric drug development. GPR151 shows high sequence similarity with galanin receptors (GALR). GPR151 is a member of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320133  Cd Length: 280  Bit Score: 169.51  E-value: 4.06e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  26 LVPLFFALIFLVGAVGNALVLAVLL--RGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFL 103
Cdd:cd15002    1 LVPILLGVICLLGFAGNLMVIGILLnnARKGKPSLIDSLILNLSAADLLLLLFSVPFRAAAYSKGSWPLGWFVCKTADWF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRElRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRR 183
Cdd:cd15002   81 GHACMAAKSFTIAVLAKACYMYVVNPTKQVT-IKQRRITAVVASIWVPACLLPLPQWLFRTVKQSEGVYLCILCIPPLAH 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 184 R---AMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAgSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWF 260
Cdd:cd15002  160 EfmsAFVKLYPLFVFCLPLTFALFYFWRAYGQCQRRGTKTQN-LRNQIRSRKLTHMLLSVVLAFTILWLPEWVAWLWLIH 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 161353471 261 GRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15002  239 IKSSGSSPPQLFNVLAQLLAFSISSVNPIIFLLMSEEFREGF 280
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
24-302 4.42e-49

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334  Cd Length: 269  Bit Score: 169.11  E-value: 4.42e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  24 AVLVPLFfALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFL 103
Cdd:cd15206    1 ELIIPLY-SVIFLLAVVGNILVIVTLVQNKRMRTVTNVFLLNLAVSDLLLAVFCMPFTLVGQLLRNFIFGEVMCKLIPYF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYysqSQLANLT-----VCHPAW 178
Cdd:cd15206   80 QAVSVSVSTFTLVAISLERYFAICHPLKSRVWQTLSHAYKVIAGIWLLSFLIMSPILVF---SNLIPMSrpgghKCREVW 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 179 -SAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWrtvdpvaagsgsqRAKRKVTRMIVIVAVLFCLCWMPHHalILC 257
Cdd:cd15206  157 pNEIAEQAWYVFLDLMLLVIPGLVMSVAYGLISWTLL-------------EAKKRVIRMLFVIVVEFFICWTPLY--VIN 221
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 161353471 258 VWFGRFPLTRATYALRI---LSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15206  222 TWKAFDPPSAARYVSSTtisLIQLLAYISSCVNPITYCFMNKRFRQAF 269
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
29-302 9.83e-48

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222  Cd Length: 282  Bit Score: 165.73  E-value: 9.83e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  29 LFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCcVPFQATIYTLDDWVFGSLLCKAVHFLIFLTM 108
Cdd:cd15094    5 VLYGLICIVGLVGNGLVIYVVLRYAKMKTVTNLYILNLAVADECFLIG-LPFLIVTMILKYWPFGAAMCKIYMVLTSINQ 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 109 HASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAW----SAPRRR 184
Cdd:cd15094   84 FTSSFTLTVMSADRYLAVCHPIRSMRYRTPFIAKVVCATTWSISFLVMLPIILYASTVPDSGRYSCTIVWpdssAVNGQK 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 185 AMDLCTFVFSYLLPVLVLSLTYARTLHYLwRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWF--GR 262
Cdd:cd15094  164 AFTLYTFLLGFAIPLLLISVFYTLVILRL-RTVGPKNKSKEKRRSHRKVTRLVLTVISVYIICWLPYWAFQVHLIFlpPG 242
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 161353471 263 FPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15094  243 TDMPKWEILMFLLLTVLSYANSMVNPLLYAFLSENFRKSF 282
7tmA_GPR83 cd15389
G protein-coupled receptor 83, member of the class A family of seven-transmembrane G ...
25-301 2.11e-47

G protein-coupled receptor 83, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR83, also known as GPR72, is widely expressed in the brain, including hypothalamic nuclei which is involved in regulating energy balance and food intake. The hypothalamic expression of GPR83 is tightly regulated in response to nutrient availability and is decreased in obese mice. A recent study suggests that GPR83 has a critical role in the regulation of systemic energy metabolism via ghrelin-dependent and ghrelin-independent mechanisms. GPR83 shares a significant amino acid sequence identity with the tachykinin receptors, however its endogenous ligand is unknown.


Pssm-ID: 320511  Cd Length: 285  Bit Score: 165.20  E-value: 2.11e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15389    1 ALLIVAYSIIIVISLFGNSLVCHVIFKNKRMHTATNLFIVNLAVSDILITLLNTPFTLVRFVNSTWVFGKIMCHLSRFAQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLAN-----LTVCHPAWS 179
Cdd:cd15389   81 YCSVYVSTLTLTAIALDRHRVILHPLKPR--ITPCQGVVVIAIIWIMASCLSLPHAIYQKLVEFEYsnertRSRCLPSFP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 180 APR---RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTvDPVAAGSGSQ-----RAKRKVTRMIVIVAVLFCLCWMPH 251
Cdd:cd15389  159 EPSdlfWKYLDLATFILQYVLPLLIIGVAYTRVAKKLWLR-NAIGDVTTEQyvaqrRKKKKTIKMLMLVVLLFAICWLPL 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 161353471 252 HALILCVWFGRFpltRATYALRILSHLVSYANSCVNPIVYALVSKHFRKG 301
Cdd:cd15389  238 NCYHVLLSSHPI---RSNSALFFAFHWLAMSSTCYNPFIYCWLNDSFRSE 284
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
26-300 2.18e-47

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130  Cd Length: 282  Bit Score: 164.92  E-value: 2.18e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  26 LVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFiLCCVPFQATIYTLDDWVFGSLLCKAVHFLIF 105
Cdd:cd14999    1 AIGTVLSLMCVVGVAGNVYTLVVMCLSMRPRASMYVYILNLALADLLY-LLTIPFYVSTYFLKKWYFGDVGCRLLFSLDF 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 106 LTMHASSFTLAAVSLDRYLAIRYPLHSRElRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQ-----LANLTVCHPAWSA 180
Cdd:cd14999   80 LTMHASIFTLTVMSTERYLAVVKPLDTVK-RSKSYRKLLAGVIWLLSLLLTLPMAIMIRLVTvedksGGSKRICLPTWSE 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 181 PRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWF 260
Cdd:cd14999  159 ESYKVYLTLLFSTSIVIPGLVIGYLYIRLARKYWLSQAAASNSSRKRLPKQKVLKMIFTIVLVFWACFLPFWIWQLLYLY 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 161353471 261 GRFPL--TRATYALRILSHLVSYANSCVNPIVYALVSKHFRK 300
Cdd:cd14999  239 SPSLSlsPRTTTYVNYLLTCLTYSNSCINPFLYTLLTKNYKE 280
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
25-302 2.85e-47

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaeastagnalis.


Pssm-ID: 320515  Cd Length: 288  Bit Score: 164.89  E-value: 2.85e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI 104
Cdd:cd15393    1 VLLSILYGIISLVAVVGNFLVIWVVAKNRRMRTVTNIFIANLAVADIIIGLFSIPFQFQAALLQRWVLPRFMCPFCPFVQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 105 FLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLA----NLTV--CHPAW 178
Cdd:cd15393   81 VLSVNVSVFTLTVIAVDRYRAVIHPLKAR--CSKKSAKIIILIIWILALLVALPVALALRVEELTdktnNGVKpfCLPVG 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 179 SAPR-RRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGS----GSQRAKRKVTRMIVIVAVLFCLCWMP--- 250
Cdd:cd15393  159 PSDDwWKIYNLYLVCVQYFVPLVIICYAYTRIAVKIWGTKAPGNAQDvrddEILKNKKKVIKMLIIVVALFALCWLPlqt 238
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 161353471 251 ------------HHALILCVWFgrfpltratyalriLSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd15393  239 ynllneikpeinKYKYINIIWF--------------CSHWLAMSNSCYNPFIYGLYNEKFKREF 288
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
25-302 5.19e-47

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 164.10  E-value: 5.19e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCcVPFQATIYTLD-DWVFGSLLCKAVHFL 103
Cdd:cd14985    1 VVIPAFYIAIFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLVFVLT-LPLWATYTANQyDWPFGDFLCKVSSYA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANL--TVC-----HP 176
Cdd:cd14985   80 ITVNMFASVFLLTCMSVDRYLAIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFLLRSLQALPDLnkTACielypHE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 177 AWSAprrrAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGsgsQRAKRKVTRMIVIVAVLFCLCWMPHHALI- 255
Cdd:cd14985  160 AWHV----GLSLVLNILGFVLPLVIILTCYCHIARTLRTHYERTGKG---GRKRRKSLKIIFAVVVAFLVCWLPFHVFKf 232
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 161353471 256 ------LCVWFGRFPLTRATYALRIlSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14985  233 ldflaqLGAIRPCFWEAFLDLGLPI-ATCLAFTNSCLNPFIYVFFDRRFRQKV 284
7tmA_NTSR-like cd14979
neurotensin receptors and related G protein-coupled receptors, member of the class A family of ...
25-302 9.12e-47

neurotensin receptors and related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the neurotensin receptors and related G-protein coupled receptors, including neuromedin U receptors, growth hormone secretagogue receptor, motilin receptor, the putative GPR39 and the capa receptors from insects. These receptors all bind peptide hormones with diverse physiological effects. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320110  Cd Length: 300  Bit Score: 163.68  E-value: 9.12e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQAT-IYTLDDWVFGSLLCKAVHFL 103
Cdd:cd14979    1 VLVTAIYVAIFVVGIVGNLLTCIVIARHKSLRTTTNYYLFSLAVSDLLILLVGLPVELYnFWWQYPWAFGDGGCKLYYFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 104 IFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGP--------YLSYYSQSQLANLTVCH 175
Cdd:cd14979   81 FEACTYATVLTIVALSVERYVAICHPLKAKTLVTKRRVKRFILAIWLVSILCAIPilflmgiqYLNGPLPGPVPDSAVCT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 176 PAWSAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVD----------PVAAGSGSQRAKRKVTRMIVIVAVLFC 245
Cdd:cd14979  161 LVVDRSTFKYVFQVSTFIFFVLPMFVISILYFRIGVKLRSMRNikkgtraqgtRNVELSLSQQARRQVVKMLGAVVIAFF 240
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 246 LCWMPHHA--LILCVWFGR-FPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 302
Cdd:cd14979  241 VCWLPFHAqrLMFSYASKEdTFLFDFYQYLYPISGILFYLSSAINPILYNLMSSRFRVAF 300
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
25-302 1.55e-45

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514  Cd Length: 287  Bit Score: 160.22  E-value: 1.55e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471  25 VLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQ--ATIYtLDDWVFGSLLCKAVHF 102
Cdd:cd15392    1 VIIILMYSTIFVLAVGGNGLVCYIVVSYPRMRTVTNYFIVNLALSDILMAVFCVPFSfiALLI-LQYWPFGEFMCPVVNY 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 103 LIFLTMHASSFTLAAVSLDRYLAIRYPLHSRelRTPRNALAAIGLIWGLALLFSGPYLSYYS----QSQLANLTVCHPAW 178
Cdd:cd15392   80 LQAVSVFVSAFTLVAISIDRYVAIMWPLRPR--MTKRQALLLIAVIWIFALATALPIAITSRlfedSNASCGQYICTESW 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161353471 179 -SAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLW--RTVDPVAAGSGSQRA--KRKVTRMIVIVAVLFCLCWMPHHA 253
Cdd:cd15392  158 pSDTNRYIYSLVLMILQYFVPLAVLVFTYTRIGIVVWakRTPGEAENNRDQRMAesKRKLVKMMITVVAIFALCWLPLNI 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 161353471 254 LIL-------CVWFGRFPLtratyaLRILS