NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16127542|ref|NP_422106|]
View 

hypothetical protein CC_3312 [Caulobacter crescentus CB15]

Protein Classification

AarF family protein (domain architecture ID 11429476)

AarF family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
1-451 1.86e-125

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


:

Pssm-ID: 223733  Cd Length: 517  Bit Score: 377.81  E-value: 1.86e-125
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   1 MADDARDPERDRLTGRLSRFAKVGAGLSGAAVSYGANRVFGGDEADARNAKALKAALGGLKGPLMKAAQMFATVPDLLPP 80
Cdd:COG0661   9 RLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPP 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  81 EFAKELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESD 160
Cdd:COG0661  89 EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEAD 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 161 LGQLRALIALIKRMDG---ALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWL 237
Cdd:COG0661 169 LKLLRRLARLIKRLPPggrRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWI 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 238 DGQGLLTFKSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNYTFAGEGaaHLNLLDFGCIRIFPPKFVAGVVRL 315
Cdd:COG0661 249 DGIKISDIAALKSAGIDRkeLAELLVRAFLRQLLRDGFFHADPHPGNILVRSDG--RIVLLDFGIVGRLDPKFRRYLAEL 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 316 YRALANDDRSEQVEAYRSWGFQG---LSDPLVDALNVWARFIYGPLLDDRERTVADDVPPGEYGRREAFKVRQALKAVGG 392
Cdd:COG0661 327 LLAFLNRDYDRVAELHVELGYVPpdtDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRT 406
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 16127542 393 VTIPREFVFMDRAAIGLGAAFLHLGARHNWRRMFEASLEGFSEEAVAERQAKALSFVGL 451
Cdd:COG0661 407 LLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSPKLLRELKDEAVAVLNALPLLPRLL 465
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
1-451 1.86e-125

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


Pssm-ID: 223733  Cd Length: 517  Bit Score: 377.81  E-value: 1.86e-125
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   1 MADDARDPERDRLTGRLSRFAKVGAGLSGAAVSYGANRVFGGDEADARNAKALKAALGGLKGPLMKAAQMFATVPDLLPP 80
Cdd:COG0661   9 RLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPP 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  81 EFAKELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESD 160
Cdd:COG0661  89 EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEAD 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 161 LGQLRALIALIKRMDG---ALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWL 237
Cdd:COG0661 169 LKLLRRLARLIKRLPPggrRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWI 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 238 DGQGLLTFKSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNYTFAGEGaaHLNLLDFGCIRIFPPKFVAGVVRL 315
Cdd:COG0661 249 DGIKISDIAALKSAGIDRkeLAELLVRAFLRQLLRDGFFHADPHPGNILVRSDG--RIVLLDFGIVGRLDPKFRRYLAEL 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 316 YRALANDDRSEQVEAYRSWGFQG---LSDPLVDALNVWARFIYGPLLDDRERTVADDVPPGEYGRREAFKVRQALKAVGG 392
Cdd:COG0661 327 LLAFLNRDYDRVAELHVELGYVPpdtDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRT 406
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 16127542 393 VTIPREFVFMDRAAIGLGAAFLHLGARHNWRRMFEASLEGFSEEAVAERQAKALSFVGL 451
Cdd:COG0661 407 LLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSPKLLRELKDEAVAVLNALPLLPRLL 465
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
84-335 1.25e-88

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270872  Cd Length: 251  Bit Score: 274.00  E-value: 1.25e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  84 KELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQ 163
Cdd:cd13970   1 EALARLRDSAPPMPWAQLEKVLEAELGEDWRELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 164 LRALIALIKRMDGALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLL 243
Cdd:cd13970  81 LRRLLKLTGLLPKGLDLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVDGVPLD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 244 TFKSAPQAVRDRIAALLFEAWWSPMTHLGIIHGDPHLGNYTFAgEGAAHLNLLDFGCIRIFPPKFVAGVVRLYRALANDD 323
Cdd:cd13970 161 EAADLSQEERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYD-PEDGRLGLLDFGAVREYPPEFVDGYRRLVRAALEGD 239
                       250
                ....*....|..
gi 16127542 324 RSEQVEAYRSWG 335
Cdd:cd13970 240 REALLEASVELG 251
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
50-299 4.54e-36

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273909  Cd Length: 437  Bit Score: 138.97  E-value: 4.54e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542    50 AKALKAALGGLkGPL-MKAAQMFATVPDLLPPEFAKELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAA 128
Cdd:TIGR01982  50 GERLRLALEEL-GPTfIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEFEEKPLAAA 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   129 SLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALIALI-KRMDGA--LDPSEAIVEIGDRLREELDYGREAKLMA 205
Cdd:TIGR01982 129 SIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVeRLSPDSrrLRPTEVVKEFEKTLRRELDLRREAANAS 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   206 VYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLLTFKSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNY 283
Cdd:TIGR01982 209 ELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRkaLAENLARSFLNQVLRDGFFHADLHPGNI 288
                         250
                  ....*....|....*.
gi 16127542   284 TFAGEGaaHLNLLDFG 299
Cdd:TIGR01982 289 FVLKDG--KIIALDFG 302
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a ...
108-221 6.29e-27

ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 281150  Cd Length: 117  Bit Score: 104.96  E-value: 6.29e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   108 ELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALIALIKRM--DGALDPSEAIV 185
Cdd:pfam03109   1 ELGAPVEEIFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLLLLKFLAKVLERFfpGFRLDLDWIVD 80
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 16127542   186 EIGDRLREELDYGREAKLMAVYANFFADRADIRTPE 221
Cdd:pfam03109  81 EFRKSLPQELDFLREAANAEKFRENFADDPWVYVPK 116
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
53-239 2.86e-23

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 102.29  E-value: 2.86e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   53 LKAALGGLkGPL-MKAAQMFATVPDLLPPEFAKELAELQTNAPamgwPF----VRRRMAAELGADWQARFTSFEPEAAAA 127
Cdd:PRK04750  55 LRLALEEL-GPIfVKFGQMLSTRRDLFPPDIADELALLQDRVP----PFdgalARAIIEKALGGPVEEWFDDFDIKPLAS 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  128 ASLGQVHRAVAHD-GRALAVKLQYPDMQSAVESDLGQLRALIALIKRM--DGA-LDPSEAIVEIGDRLREELDYGREAKL 203
Cdd:PRK04750 130 ASIAQVHFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERLlpDGRrLKPREVVAEFEKTLHDELDLMREAAN 209
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 16127542  204 MAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDG 239
Cdd:PRK04750 210 ASQLRRNFEDSDMLYVPEVYWDYCSETVMVMERMYG 245
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family ...
1-451 1.86e-125

Predicted unusual protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family [Coenzyme transport and metabolism, Signal transduction mechanisms];


Pssm-ID: 223733  Cd Length: 517  Bit Score: 377.81  E-value: 1.86e-125
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   1 MADDARDPERDRLTGRLSRFAKVGAGLSGAAVSYGANRVFGGDEADARNAKALKAALGGLKGPLMKAAQMFATVPDLLPP 80
Cdd:COG0661   9 RLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPP 88
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  81 EFAKELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESD 160
Cdd:COG0661  89 EYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEAD 168
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 161 LGQLRALIALIKRMDG---ALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWL 237
Cdd:COG0661 169 LKLLRRLARLIKRLPPggrRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVLTMEWI 248
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 238 DGQGLLTFKSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNYTFAGEGaaHLNLLDFGCIRIFPPKFVAGVVRL 315
Cdd:COG0661 249 DGIKISDIAALKSAGIDRkeLAELLVRAFLRQLLRDGFFHADPHPGNILVRSDG--RIVLLDFGIVGRLDPKFRRYLAEL 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 316 YRALANDDRSEQVEAYRSWGFQG---LSDPLVDALNVWARFIYGPLLDDRERTVADDVPPGEYGRREAFKVRQALKAVGG 392
Cdd:COG0661 327 LLAFLNRDYDRVAELHVELGYVPpdtDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRT 406
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 16127542 393 VTIPREFVFMDRAAIGLGAAFLHLGARHNWRRMFEASLEGFSEEAVAERQAKALSFVGL 451
Cdd:COG0661 407 LLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSPKLLRELKDEAVAVLNALPLLPRLL 465
ABC1_ADCK3 cd13970
Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This ...
84-335 1.25e-88

Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3; This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270872  Cd Length: 251  Bit Score: 274.00  E-value: 1.25e-88
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  84 KELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQ 163
Cdd:cd13970   1 EALARLRDSAPPMPWAQLEKVLEAELGEDWRELFAEFDEEPFAAASIGQVHRATLKDGREVAVKVQYPGVAESIDSDLNN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 164 LRALIALIKRMDGALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLL 243
Cdd:cd13970  81 LRRLLKLTGLLPKGLDLDALIAELREELLEECDYEREAANQRRFRELLADDPRFVVPEVIPELSTKRVLTTEFVDGVPLD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 244 TFKSAPQAVRDRIAALLFEAWWSPMTHLGIIHGDPHLGNYTFAgEGAAHLNLLDFGCIRIFPPKFVAGVVRLYRALANDD 323
Cdd:cd13970 161 EAADLSQEERNRIGELLLRLCLRELFEFGFMQTDPNPGNFLYD-PEDGRLGLLDFGAVREYPPEFVDGYRRLVRAALEGD 239
                       250
                ....*....|..
gi 16127542 324 RSEQVEAYRSWG 335
Cdd:cd13970 240 REALLEASVELG 251
ABC1_ADCK3-like cd05121
Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and ...
89-330 1.71e-54

Activator of bc1 complex (ABC1) kinases (also called aarF domain containing kinase 3) and similar proteins; This family is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. Eukaryotes contain at least two more ABC1/ADCK3-like proteins: in humans, these are the putative atypical protein kinases named ADCK1 and ADCK2. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Eight of these plant ABC1 kinase subfamilies (ABC1K1-8) are specific for photosynthetic organisms. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270691  Cd Length: 247  Bit Score: 184.62  E-value: 1.71e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  89 LQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALI 168
Cdd:cd05121   2 LQDDVPPFPFEEVRKIIEEELGRPLEEVFAEFDPEPLAAASIAQVHRARLKDGREVAVKVQRPGIEEIIEADLRILRRLA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 169 ALIKRMDGAL---DPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLLTF 245
Cdd:cd05121  82 RLLERLSPLLrrlDLVAIVDEFARSLLEELDFRREARNAERFRKNLKDSPDVYVPKVYPELSTRRVLVMEYIDGVKLTDL 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 246 KSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNYTFAGEGaaHLNLLDFGCIRIFPPKFVAGVVRLYRALANDD 323
Cdd:cd05121 162 EALRAAGIDRkeLARRLVDAYLKQIFEDGFFHADPHPGNILVLPDG--RIALLDFGMVGRLDPETREALADLLLALVNGD 239

                ....*..
gi 16127542 324 RSEQVEA 330
Cdd:cd05121 240 AEGLAEA 246
ADCK1-like cd13969
aarF domain containing kinase 1 and similar proteins; This subfamily is composed of ...
88-335 3.99e-40

aarF domain containing kinase 1 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 1 (ADCK1). Eukaryotes contain at least three ABC1-like proteins: in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamilies 14 and 15 (ABC1K14-15) belong to the same group of ABC1 kinases as human ADCK1. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270871  Cd Length: 253  Bit Score: 146.09  E-value: 3.99e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  88 ELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRAL 167
Cdd:cd13969   1 VLQDKAPQSPYEEVRRVFKEDLGKPPEELFSEFDEEPIASASLAQVHKAKLKDGEEVAVKVQHPDLRKQFAGDLATMEFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 168 IALIKRMDGALDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDG-------- 239
Cdd:cd13969  81 VNLVEKLFPDFPFSWLVDELKKNLPKELDFLNEARNAERCAKLFKHRPDVYVPKVYWDLSSKRVLTMEFIDGikiddvea 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 240 ---QGLLTFKsapqavrdrIAALLFEAwWSPMTHL-GIIHGDPHLGNyTFA----GEGAAHLNLLDFGCIRIFPPKFVAG 311
Cdd:cd13969 161 lkkLGIDPKE---------VARLLSEA-FAEMIFVhGFVHCDPHPGN-LLVrknpGPGKPQIVLLDHGLYRELDEEFRLN 229
                       250       260
                ....*....|....*....|....
gi 16127542 312 VVRLYRALANDDRSEQVEAYRSWG 335
Cdd:cd13969 230 YCRLWKALILGDEKKIKKYSKALG 253
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
50-299 4.54e-36

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273909  Cd Length: 437  Bit Score: 138.97  E-value: 4.54e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542    50 AKALKAALGGLkGPL-MKAAQMFATVPDLLPPEFAKELAELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAA 128
Cdd:TIGR01982  50 GERLRLALEEL-GPTfIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEFEEKPLAAA 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   129 SLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALIALI-KRMDGA--LDPSEAIVEIGDRLREELDYGREAKLMA 205
Cdd:TIGR01982 129 SIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVeRLSPDSrrLRPTEVVKEFEKTLRRELDLRREAANAS 208
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   206 VYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLLTFKSAPQAVRDR--IAALLFEAWWSPMTHLGIIHGDPHLGNY 283
Cdd:TIGR01982 209 ELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRkaLAENLARSFLNQVLRDGFFHADLHPGNI 288
                         250
                  ....*....|....*.
gi 16127542   284 TFAGEGaaHLNLLDFG 299
Cdd:TIGR01982 289 FVLKDG--KIIALDFG 302
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a ...
108-221 6.29e-27

ABC1 family; This family includes ABC1 from yeast and AarF from E. coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 281150  Cd Length: 117  Bit Score: 104.96  E-value: 6.29e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   108 ELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALIALIKRM--DGALDPSEAIV 185
Cdd:pfam03109   1 ELGAPVEEIFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLLLLKFLAKVLERFfpGFRLDLDWIVD 80
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 16127542   186 EIGDRLREELDYGREAKLMAVYANFFADRADIRTPE 221
Cdd:pfam03109  81 EFRKSLPQELDFLREAANAEKFRENFADDPWVYVPK 116
ADCK2-like cd13971
aarF domain containing kinase 2 and similar proteins; This subfamily is composed of ...
88-299 5.51e-24

aarF domain containing kinase 2 and similar proteins; This subfamily is composed of uncharacterized ABC1 kinase-like proteins including the human protein called aarF domain containing kinase 2 (ADCK2). Eukaryotes contain at least three ABC1-like proteins; in humans, these are ADCK3 and the putative protein kinases named ADCK1 and ADCK2. Yeast Abc1p and its human homolog ADCK3 are atypical protein kinases required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Plant subfamily 10 (ABC1K10) belong to the same group of ABC1 kinases as human ADCK2. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.


Pssm-ID: 270873  Cd Length: 298  Bit Score: 101.14  E-value: 5.51e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  88 ELQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHD--------GRALAVKLQYPDMQSAVES 159
Cdd:cd13971   1 KLHSNAPPHSWAHTERALEAAFGKDWEDIFEEFDEEPIGSGSIAQVHRAKLKPdyggdgggPRVVAVKVLHPGVREQIER 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 160 DLGQLRALIALIKRMDG--ALDPSEAIVEIGDRLREELDYGREAK-LMAVYANfFADRADIRTPEPVPELSTGRLLSMTW 236
Cdd:cd13971  81 DLAILRLFAKLLEAIPPlrWLSLPESVEQFASLMLRQLDLRVEAAnLERFREN-FKDRKDVSFPKPLYPLVTEEVLVETF 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 237 LDGQGLLTFKSAPQAV--RDRIAALLFEAWWSPMTHLGIIHGDPHLGN--YTFAGEGAA-------------HLNLLDFG 299
Cdd:cd13971 160 EEGVPISRTVLAHGGEplKRKLARIGLDAFLKMLFVDNFVHGDLHPGNilVRFNDSNRPsllvsldargsppRLVFLDAG 239
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
53-239 2.86e-23

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 102.29  E-value: 2.86e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542   53 LKAALGGLkGPL-MKAAQMFATVPDLLPPEFAKELAELQTNAPamgwPF----VRRRMAAELGADWQARFTSFEPEAAAA 127
Cdd:PRK04750  55 LRLALEEL-GPIfVKFGQMLSTRRDLFPPDIADELALLQDRVP----PFdgalARAIIEKALGGPVEEWFDDFDIKPLAS 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  128 ASLGQVHRAVAHD-GRALAVKLQYPDMQSAVESDLGQLRALIALIKRM--DGA-LDPSEAIVEIGDRLREELDYGREAKL 203
Cdd:PRK04750 130 ASIAQVHFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERLlpDGRrLKPREVVAEFEKTLHDELDLMREAAN 209
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 16127542  204 MAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDG 239
Cdd:PRK04750 210 ASQLRRNFEDSDMLYVPEVYWDYCSETVMVMERMYG 245
UbiB cd13972
Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ...
89-299 8.74e-21

Ubiquinone biosynthetic protein UbiB; UbiB is the prokaryotic homolog of yeast Abc1p and human ADCK3 (aarF domain containing kinase 3). It is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is required in the first monooxygenase step in Q biosynthesis. Mutant strains with disrupted ubiB genes lack Q and accumulate octaprenylphenol, a Q biosynthetic intermediate.


Pssm-ID: 270874  Cd Length: 247  Bit Score: 91.49  E-value: 8.74e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  89 LQTNAPAMGWPFVRRRMAAELGADWQARFTSFEPEAAAAASLGQVHRAVAHDGRALAVKLQYPDMQSAVESDLGQLRALI 168
Cdd:cd13972   2 LQDRVPPFSGKEARAIIEAELGKPLDALFSDFDEEPVAAASIAQVHKARLLDGREVAVKVLRPGIEKRIERDLELLRFLA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 169 ALIKRMDGA---LDPSEAIVEIGDRLREELDYGREAKLMAVYANFFADRADIRTPEPVPELSTGRLLSMTWLDGQGLltf 245
Cdd:cd13972  82 RLAERLLPEarrLRPVEVVKEFARSLLLELDLRLEAANASELRENFLDDPGFYVPEVYWELTSKNVLTMEWIDGIPI--- 158
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542 246 kSAPQAV------RDRIAALLFEAWWSPMTHLGIIHGDPHLGNyTFAGEGAAhLNLLDFG 299
Cdd:cd13972 159 -SDIEALdaagidRKALAERLVEIFFRQVFRDGFFHADMHPGN-IFVDPNGR-IIAVDFG 215
PRK14879 PRK14879
serine/threonine protein kinase; Provisional
170-299 5.93e-03

serine/threonine protein kinase; Provisional


Pssm-ID: 237847  Cd Length: 211  Bit Score: 37.96  E-value: 5.93e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  170 LIKRmdGAldpsEAIVEIGDRLRE---------------ELDYG-------REAKLMAVyanffADRADIRTPEPV---P 224
Cdd:PRK14879   3 LIKR--GA----EAEIYLGDFLGIkavikwripkryrhpELDERirrertrREARIMSR-----ARKAGVNVPAVYfvdP 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127542  225 ELStgrLLSMTWLDGQGLLT-----FKSAPQAVRD--RIAALLFEAwwspmthlGIIHGDPHLGNYTFAGEGaahLNLLD 297
Cdd:PRK14879  72 ENF---IIVMEYIEGEPLKDlinsnGMEELELSREigRLVGKLHSA--------GIIHGDLTTSNMILSGGK---IYLID 137

                 ..
gi 16127542  298 FG 299
Cdd:PRK14879 138 FG 139
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH