NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15967159|ref|NP_277042|]
View 

glucokinase isoform 2 [Homo sapiens]

Protein Classification

Hexokinase_2 and NBD_sugar-kinase_HSP70_actin domain-containing protein (domain architecture ID 11993074)

Hexokinase_2 and NBD_sugar-kinase_HSP70_actin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Hexokinase_1 pfam00349
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
17-216 7.48e-96

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam03727. Some members of the family have two copies of each of these domains.


:

Pssm-ID: 306785  Cd Length: 196  Bit Score: 290.89  E-value: 7.48e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGE 96
Cdd:pfam00349   2 VEEILKQFALSDEKLREIVDRFVEEMEKGL--AKEGTSSLKMLPTYVTSLPTGTEKGTFLALDLGGTNFRVCLVELLGDG 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    97 EgqwsVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKH--KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKA 174
Cdd:pfam00349  80 K----FSITQEKYPIPEELMTGTGEELFDFIADCIAEFLEEHGLEDdeEKLPLGFTFSFPVEQTSLDSGTLIRWTKGFDI 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 15967159   175 SGAEGNNVVGLLRDAIKRRGDfEMDVVAMVNDTVATMISCYY 216
Cdd:pfam00349 156 PGVVGKDVVQLLQEALERRGL-PVKVVALVNDTVGTLMACAY 196
Hexokinase_2 super family cl27242
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
17-459 2.17e-92

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam00349. Some members of the family have two copies of each of these domains.


The actual alignment was detected with superfamily member COG5026:

Pssm-ID: 332063  Cd Length: 466  Bit Score: 291.23  E-value: 2.17e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGege 96
Cdd:COG5026  21 VEELVESFTVPTEDLREVVKAFIEELEKGL--QPKSGDFLPMIPTWVAPLPTGNESGSVLAIDLGGTNLRVCLVVLG--- 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  97 eGQWSVKTKHQMYSIPEDAMTG-TAEMLFDYISECISDFLDKH--QMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFK 173
Cdd:COG5026  96 -GDGTFDIEQSKSFLPVECRDSeSRDELFGFIADRLAAFIKEQhpSGYGSKLPIGFTFSYPLNQTSINEGQLIRWTKGFD 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 174 ASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGD----E 249
Cdd:COG5026 175 IPEVIGTDVVRLLQEALSARN-LPIRVVAVINDTTGTLLASVYTSSETIIGIIFGTGTNGCYCEPKGRIPKLPRDdlpeT 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 250 GRMCVNTEWGAFgdsgelDEFLLE-----YDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ 324
Cdd:COG5026 254 GPMLINCEWGSF------DNELSVlprtkYDVLIDQESPNPGHQIFEKMSSGMYLGELLRLILRNLYEQGLIFNGQDPEK 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 325 LRTRGAFETRFVSQVESD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAG-VINRMRESRSEd 401
Cdd:COG5026 328 LTDPFALSTSVLSRIEEDpfENLRNTLTTFLNDFRAPTTKEERKLIRRLVELIGRRAARLAAVPIAAiVIKTGAYKAYH- 406
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 402 vmritVGVDGSVYKLHPSFKERFHASVRRL--TPSCEITFIESEEGSGRGAALVSAVACK 459
Cdd:COG5026 407 -----VGADGSVIERYPGFRSMLREALKALlgEEGEKIKIKPAEDGSGLGAALCALLAQK 461
 
Name Accession Description Interval E-value
Hexokinase_1 pfam00349
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
17-216 7.48e-96

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam03727. Some members of the family have two copies of each of these domains.


Pssm-ID: 306785  Cd Length: 196  Bit Score: 290.89  E-value: 7.48e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGE 96
Cdd:pfam00349   2 VEEILKQFALSDEKLREIVDRFVEEMEKGL--AKEGTSSLKMLPTYVTSLPTGTEKGTFLALDLGGTNFRVCLVELLGDG 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    97 EgqwsVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKH--KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKA 174
Cdd:pfam00349  80 K----FSITQEKYPIPEELMTGTGEELFDFIADCIAEFLEEHGLEDdeEKLPLGFTFSFPVEQTSLDSGTLIRWTKGFDI 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 15967159   175 SGAEGNNVVGLLRDAIKRRGDfEMDVVAMVNDTVATMISCYY 216
Cdd:pfam00349 156 PGVVGKDVVQLLQEALERRGL-PVKVVALVNDTVGTLMACAY 196
COG5026 COG5026
Hexokinase [Carbohydrate transport and metabolism];
17-459 2.17e-92

Hexokinase [Carbohydrate transport and metabolism];


Pssm-ID: 227359  Cd Length: 466  Bit Score: 291.23  E-value: 2.17e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGege 96
Cdd:COG5026  21 VEELVESFTVPTEDLREVVKAFIEELEKGL--QPKSGDFLPMIPTWVAPLPTGNESGSVLAIDLGGTNLRVCLVVLG--- 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  97 eGQWSVKTKHQMYSIPEDAMTG-TAEMLFDYISECISDFLDKH--QMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFK 173
Cdd:COG5026  96 -GDGTFDIEQSKSFLPVECRDSeSRDELFGFIADRLAAFIKEQhpSGYGSKLPIGFTFSYPLNQTSINEGQLIRWTKGFD 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 174 ASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGD----E 249
Cdd:COG5026 175 IPEVIGTDVVRLLQEALSARN-LPIRVVAVINDTTGTLLASVYTSSETIIGIIFGTGTNGCYCEPKGRIPKLPRDdlpeT 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 250 GRMCVNTEWGAFgdsgelDEFLLE-----YDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ 324
Cdd:COG5026 254 GPMLINCEWGSF------DNELSVlprtkYDVLIDQESPNPGHQIFEKMSSGMYLGELLRLILRNLYEQGLIFNGQDPEK 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 325 LRTRGAFETRFVSQVESD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAG-VINRMRESRSEd 401
Cdd:COG5026 328 LTDPFALSTSVLSRIEEDpfENLRNTLTTFLNDFRAPTTKEERKLIRRLVELIGRRAARLAAVPIAAiVIKTGAYKAYH- 406
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 402 vmritVGVDGSVYKLHPSFKERFHASVRRL--TPSCEITFIESEEGSGRGAALVSAVACK 459
Cdd:COG5026 407 -----VGADGSVIERYPGFRSMLREALKALlgEEGEKIKIKPAEDGSGLGAALCALLAQK 461
PTZ00107 PTZ00107
hexokinase; Provisional
18-457 2.12e-91

hexokinase; Provisional


Pssm-ID: 240270  Cd Length: 464  Bit Score: 288.88  E-value: 2.12e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   18 EQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETH---------EEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVM 88
Cdd:PTZ00107  12 ASLVNQFTMSKEKLKELVDYFLYELVEGL--EAHrrhrnlwipNECSFKMLDSCVYNLPTGKEKGVYYAIDFGGTNFRAV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   89 LVKVGEGEEgqwsVKTKHQMYSIPEDAMTG---------TAEMLFDYISECISDFLDKHQMK---HKKLPLGFTFSFPVR 156
Cdd:PTZ00107  90 RVSLRGGGK----MERTQSKFSLPKSALLGekglldkkaTATDLFDHIAKSIKKMMEENGDPedlNKPVPVGFTFSFPCT 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  157 HEDIDKGILLNWTKGFKASGA-----EGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDH----QCEVGMIV 227
Cdd:PTZ00107 166 QLSVNNAILIDWTKGFETGRAtndpvEGKDVGELLNDAFKRNN-VPANVVAVLNDTVGTLISCAYQKPkntpPCQVGVII 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  228 GTGCNACYMEEMQnveLVEGDEGRMcVNTEWGAFgDSgELDefLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVL 307
Cdd:PTZ00107 245 GTGSNACYFEPEV---SAYGYAGTP-INMECGNF-DS-KLP--ITPYDLEMDWYTPNRGRQQFEKMISGAYLGEISRRLI 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  308 LrlvdenLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYN--ILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSA 385
Cdd:PTZ00107 317 V------HLLQLKAPPKMWQSGSFESEDASMILNDQSPDLQFSRqvIKEAWDVDLTDEDLYTIRKICELVRGRAAQLAAA 390
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 15967159  386 GLAGVINRMRESRSedvmRITVGVDGSVYKLHPSFKERFHASVRRLT--PSCEITFIESEEGSGRGAALVSAVA 457
Cdd:PTZ00107 391 FIAAPAKKTRTVQG----KATVAIDGSVYVKNPWFRRLLQEYINSILgpDAGNVVFYLADDGSGKGAAIIAAMV 460
Hexokinase_2 pfam03727
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
222-456 1.54e-87

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam00349. Some members of the family have two copies of each of these domains.


Pssm-ID: 309010  Cd Length: 236  Bit Score: 270.91  E-value: 1.54e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   222 EVGMIVGTGCNACYMEEMQNVELVEGD---EGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKY 298
Cdd:pfam03727   1 RIGLILGTGTNAAYVEKVSNIPKLEGKlpkSGEMIINTEWGAFGDNGLLPLPRTKYDKELDAESPNPGFQPFEKMISGMY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   299 MGELVRLVLLRLVDENLLFhgeASEQLRTRGAFETRFVSQVESD-TGDRKQIYNILS-TLGLRPSTT-DCDIVRRACESV 375
Cdd:pfam03727  81 LGEIVRLVLLDLAEEGLLF---GPEKLKTPYSLDTSFLSAIEEDpSEDLSETREILEeLLGIETATEeDREIVRRICEAV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   376 STRAAHMCSAGLAGVINRMRESRsedvmRITVGVDGSVYKLHPSFKERFHASVRRL---TPSCEITFIESEEGSGRGAAL 452
Cdd:pfam03727 158 STRAARLVAAGIAAILKKIGRLK-----RVTVGVDGSVYEKYPGFRERLQEALRELlgeEPGKKVVLVLAEDGSGVGAAL 232

                  ....
gi 15967159   453 VSAV 456
Cdd:pfam03727 233 IAAV 236
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
76-279 6.06e-18

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 82.25  E-value: 6.06e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  76 LSLDLGGTNFRVMLVKVGEGEEGQWSVKTkhqmySIPEDAMTGTAEMLFDYISECISDFLDkhQMKHKKLPLGFTFSFPV 155
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGEILPEEIVPT-----PVGRPGAVTDLDELEEALRELLKEALR--QLKSEIDAVGITEPGGV 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 156 RHEDIDKGILLNWtkgfkasgaegnnvvgLLRDAIKRRGDFEMDVVAMVNDTVATMISCYY--EDHQCEVGMIVGTG-CN 232
Cdd:cd00012  74 PKENREVIILPNL----------------LLIPLALALEDLGGVPVAVVNDAVAAALAEGLfgKEEDTVLVVDLGTGtTG 137
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 15967159 233 ACYMEEmqnvelvegDEGRMCVNTEWGAfgdSGELDEFLLEYDRLVD 279
Cdd:cd00012 138 IAIVED---------GKGGVGAAGELGI---AEALAAVLNLLDGLPD 172
PRK09698 PRK09698
D-allose kinase; Provisional
75-267 3.43e-06

D-allose kinase; Provisional


Pssm-ID: 182034  Cd Length: 302  Bit Score: 48.44  E-value: 3.43e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   75 FLSLDLGGTNFRVMLVKvgegEEGQWSVKTKHQmysipedamtgTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFP 154
Cdd:PRK09698   6 VLGIDMGGTHIRFCLVD----AEGEILHCEKKR-----------TAEVIAPDLVSGLGEMIDEYLRRFNARCHGIVMGFP 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  155 --VrheDIDKGILLNwTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDV-VAMVNDTVAtmiscYYEDHQCEVGMIVGTGC 231
Cdd:PRK09698  71 alV---SKDRRTVIS-TPNLPLTALDLYDLADKLENTLNCPVFFSRDVnLQLLWDVKE-----NNLTQQLVLGAYLGTGM 141
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 15967159  232 -NACYMeemqnvelvegdEGRMCVntewGAFGDSGEL 267
Cdd:PRK09698 142 gFAVWM------------NGAPWT----GAHGVAGEL 162
NagC COG1940
Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain [Transcription, ...
75-233 3.09e-03

Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain [Transcription, Carbohydrate transport and metabolism];


Pssm-ID: 224851  Cd Length: 314  Bit Score: 39.39  E-value: 3.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  75 FLSLDLGGTNFRVMLVKVGEGEEGQWSVKTkhqMYSIPEDAMTGTaemlfdyISECISDFLDKHQMKHKKLPLGFTFSFP 154
Cdd:COG1940   8 VLGIDIGGTKIKVALVDLDGEILLRERIPT---PTPDPEEAILEA-------ILALVAELLKQAQGRVAIIGIGIPGPGD 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 155 VRHEDIDKGI-LLNWTKGFKasgaegnnvvglLRDAIKRRGDFEmdvVAMVNDTVATMIS-CYYEDHQCE---VGMIVGT 229
Cdd:COG1940  78 VDNGTVIVPApNLGWWNGVD------------LAEELEARLGLP---VFVENDANAAALAeAWFGAGRGIddvVYITLGT 142

                ....
gi 15967159 230 GCNA 233
Cdd:COG1940 143 GIGG 146
 
Name Accession Description Interval E-value
Hexokinase_1 pfam00349
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
17-216 7.48e-96

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam03727. Some members of the family have two copies of each of these domains.


Pssm-ID: 306785  Cd Length: 196  Bit Score: 290.89  E-value: 7.48e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGE 96
Cdd:pfam00349   2 VEEILKQFALSDEKLREIVDRFVEEMEKGL--AKEGTSSLKMLPTYVTSLPTGTEKGTFLALDLGGTNFRVCLVELLGDG 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    97 EgqwsVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKH--KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKA 174
Cdd:pfam00349  80 K----FSITQEKYPIPEELMTGTGEELFDFIADCIAEFLEEHGLEDdeEKLPLGFTFSFPVEQTSLDSGTLIRWTKGFDI 155
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 15967159   175 SGAEGNNVVGLLRDAIKRRGDfEMDVVAMVNDTVATMISCYY 216
Cdd:pfam00349 156 PGVVGKDVVQLLQEALERRGL-PVKVVALVNDTVGTLMACAY 196
COG5026 COG5026
Hexokinase [Carbohydrate transport and metabolism];
17-459 2.17e-92

Hexokinase [Carbohydrate transport and metabolism];


Pssm-ID: 227359  Cd Length: 466  Bit Score: 291.23  E-value: 2.17e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  17 VEQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGege 96
Cdd:COG5026  21 VEELVESFTVPTEDLREVVKAFIEELEKGL--QPKSGDFLPMIPTWVAPLPTGNESGSVLAIDLGGTNLRVCLVVLG--- 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  97 eGQWSVKTKHQMYSIPEDAMTG-TAEMLFDYISECISDFLDKH--QMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFK 173
Cdd:COG5026  96 -GDGTFDIEQSKSFLPVECRDSeSRDELFGFIADRLAAFIKEQhpSGYGSKLPIGFTFSYPLNQTSINEGQLIRWTKGFD 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 174 ASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGD----E 249
Cdd:COG5026 175 IPEVIGTDVVRLLQEALSARN-LPIRVVAVINDTTGTLLASVYTSSETIIGIIFGTGTNGCYCEPKGRIPKLPRDdlpeT 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 250 GRMCVNTEWGAFgdsgelDEFLLE-----YDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ 324
Cdd:COG5026 254 GPMLINCEWGSF------DNELSVlprtkYDVLIDQESPNPGHQIFEKMSSGMYLGELLRLILRNLYEQGLIFNGQDPEK 327
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 325 LRTRGAFETRFVSQVESD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAG-VINRMRESRSEd 401
Cdd:COG5026 328 LTDPFALSTSVLSRIEEDpfENLRNTLTTFLNDFRAPTTKEERKLIRRLVELIGRRAARLAAVPIAAiVIKTGAYKAYH- 406
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 402 vmritVGVDGSVYKLHPSFKERFHASVRRL--TPSCEITFIESEEGSGRGAALVSAVACK 459
Cdd:COG5026 407 -----VGADGSVIERYPGFRSMLREALKALlgEEGEKIKIKPAEDGSGLGAALCALLAQK 461
PTZ00107 PTZ00107
hexokinase; Provisional
18-457 2.12e-91

hexokinase; Provisional


Pssm-ID: 240270  Cd Length: 464  Bit Score: 288.88  E-value: 2.12e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   18 EQILAEFQLQEEDLKKVMRRMQKEMDRGLrlETH---------EEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVM 88
Cdd:PTZ00107  12 ASLVNQFTMSKEKLKELVDYFLYELVEGL--EAHrrhrnlwipNECSFKMLDSCVYNLPTGKEKGVYYAIDFGGTNFRAV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   89 LVKVGEGEEgqwsVKTKHQMYSIPEDAMTG---------TAEMLFDYISECISDFLDKHQMK---HKKLPLGFTFSFPVR 156
Cdd:PTZ00107  90 RVSLRGGGK----MERTQSKFSLPKSALLGekglldkkaTATDLFDHIAKSIKKMMEENGDPedlNKPVPVGFTFSFPCT 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  157 HEDIDKGILLNWTKGFKASGA-----EGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDH----QCEVGMIV 227
Cdd:PTZ00107 166 QLSVNNAILIDWTKGFETGRAtndpvEGKDVGELLNDAFKRNN-VPANVVAVLNDTVGTLISCAYQKPkntpPCQVGVII 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  228 GTGCNACYMEEMQnveLVEGDEGRMcVNTEWGAFgDSgELDefLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVL 307
Cdd:PTZ00107 245 GTGSNACYFEPEV---SAYGYAGTP-INMECGNF-DS-KLP--ITPYDLEMDWYTPNRGRQQFEKMISGAYLGEISRRLI 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  308 LrlvdenLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYN--ILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSA 385
Cdd:PTZ00107 317 V------HLLQLKAPPKMWQSGSFESEDASMILNDQSPDLQFSRqvIKEAWDVDLTDEDLYTIRKICELVRGRAAQLAAA 390
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 15967159  386 GLAGVINRMRESRSedvmRITVGVDGSVYKLHPSFKERFHASVRRLT--PSCEITFIESEEGSGRGAALVSAVA 457
Cdd:PTZ00107 391 FIAAPAKKTRTVQG----KATVAIDGSVYVKNPWFRRLLQEYINSILgpDAGNVVFYLADDGSGKGAAIIAAMV 460
PLN02914 PLN02914
hexokinase
5-459 1.27e-88

hexokinase


Pssm-ID: 178502  Cd Length: 490  Bit Score: 282.54  E-value: 1.27e-88
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    5 VTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLR--LETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGG 82
Cdd:PLN02914  25 RSRMAVRSNAVSVAPILTKLQKDCATPLPVLRHVADAMAADMRagLAVDGGGDLKMILSYVDSLPSGNEKGLFYALDLGG 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   83 TNFRVMLVKVGEGEEGqwSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDK-----HQMKHKKLPLGFTFSFPVRH 157
Cdd:PLN02914 105 TNFRVLRVQLGGKDER--VIATEFEQVSIPQELMFGTSEELFDFIASGLANFVAKeggkfHLPEGRKREIGFTFSFPVKQ 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  158 EDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYME 237
Cdd:PLN02914 183 TSIDSGILMKWTKGFAVSGTAGKDVVACLNEAMERQG-LDMRVSALVNDTVGTLAGARYWDDDVMVAVILGTGTNACYVE 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  238 EMQNVELVEGDE---GRMCVNTEWGAFGDSGELDEFlleyDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDEN 314
Cdd:PLN02914 262 RTDAIPKLQGQKsssGRTIINTEWGAFSDGLPLTEF----DREMDAASINPGEQIFEKTISGMYLGEIVRRVLLKMAETS 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  315 LLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQ-----IYNIlstLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAG 389
Cdd:PLN02914 338 DLFGHFVPEKLSTPFALRTPHLCAMQQDNSDDLQavgsiLYDV---LGVEASLSARRRVVEVCDTIVKRGGRLAGAGIVG 414
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15967159  390 VINRMRESRSEDVM--RITVGVDGSVYKLHPSFKERFHASVRRL---TPSCEITFIESEEGSGRGAALVSAVACK 459
Cdd:PLN02914 415 ILEKMEEDSKGMIFgkRTVVAMDGGLYEKYPQYRRYMQDAVTELlglELSKNIAIEHTKDGSGIGAALLAATNSK 489
Hexokinase_2 pfam03727
Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by ...
222-456 1.54e-87

Hexokinase; Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam00349. Some members of the family have two copies of each of these domains.


Pssm-ID: 309010  Cd Length: 236  Bit Score: 270.91  E-value: 1.54e-87
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   222 EVGMIVGTGCNACYMEEMQNVELVEGD---EGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKY 298
Cdd:pfam03727   1 RIGLILGTGTNAAYVEKVSNIPKLEGKlpkSGEMIINTEWGAFGDNGLLPLPRTKYDKELDAESPNPGFQPFEKMISGMY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   299 MGELVRLVLLRLVDENLLFhgeASEQLRTRGAFETRFVSQVESD-TGDRKQIYNILS-TLGLRPSTT-DCDIVRRACESV 375
Cdd:pfam03727  81 LGEIVRLVLLDLAEEGLLF---GPEKLKTPYSLDTSFLSAIEEDpSEDLSETREILEeLLGIETATEeDREIVRRICEAV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   376 STRAAHMCSAGLAGVINRMRESRsedvmRITVGVDGSVYKLHPSFKERFHASVRRL---TPSCEITFIESEEGSGRGAAL 452
Cdd:pfam03727 158 STRAARLVAAGIAAILKKIGRLK-----RVTVGVDGSVYEKYPGFRERLQEALRELlgeEPGKKVVLVLAEDGSGVGAAL 232

                  ....
gi 15967159   453 VSAV 456
Cdd:pfam03727 233 IAAV 236
PLN02405 PLN02405
hexokinase
17-455 1.01e-72

hexokinase


Pssm-ID: 215226  Cd Length: 497  Bit Score: 240.89  E-value: 1.01e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   17 VEQILAEFqlqEED-------LKKVMRRMQKEMDRGLRLETHeeASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVML 89
Cdd:PLN02405  37 AMEILKEF---EEDcatpigkLRQVADAMTVEMHAGLASEGG--SKLKMLISYVDNLPSGDEKGLFYALDLGGTNFRVLR 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   90 VKVGEGEEGqwSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL-----DKHQMKHKKLPLGFTFSFPVRHEDIDKGI 164
Cdd:PLN02405 112 VLLGGKDGR--VVKQEFEEVSIPPHLMTGSSDALFDFIAAALAKFVategeDFHLPPGRQRELGFTFSFPVKQTSISSGT 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  165 LLNWTKGFKASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVEL 244
Cdd:PLN02405 190 LIKWTKGFSIDDAVGQDVVGELTKAMERVG-LDMRVSALVNDTIGTLAGGRYYNPDVVAAVILGTGTNAAYVERAQAIPK 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  245 VEGD---EGRMCVNTEWGAFgDSGELDefLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEA 321
Cdd:PLN02405 269 WHGLlpkSGEMVINMEWGNF-RSSHLP--LTEYDHALDVESLNPGEQIFEKIISGMYLGEILRRVLLKMAEEAAFFGDTV 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  322 SEQLRTRGAFETRFVSQVESDTG-DRKQIYNILSTLgLRPSTTDCD---IVRRACESVSTRAAHMCSAGLAGVINRM-RE 396
Cdd:PLN02405 346 PPKLKIPFILRTPDMSAMHHDTSpDLKVVGSKLKDI-LEIPNTSLKmrkVVVELCNIVATRGARLSAAGIYGILKKLgRD 424
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15967159  397 S-RSEDVMRITVGVDGSVYKLHPSFKERFHASVRRL---TPSCEITFIESEEGSGRGAALVSA 455
Cdd:PLN02405 425 TvKDGEKQKSVIAMDGGLFEHYTEFSKCMESTLKELlgeEVSESIEVEHSNDGSGIGAALLAA 487
PLN02362 PLN02362
hexokinase
31-455 1.05e-68

hexokinase


Pssm-ID: 215206  Cd Length: 509  Bit Score: 230.54  E-value: 1.05e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   31 LKKVMRRMQKEMDRGLRLETHeeASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQmyS 110
Cdd:PLN02362  55 LRQVVDAMAVEMHAGLASEGG--SKLKMLLTFVDDLPTGSEIGTYYALDLGGTNFRVLRVQLGGQRSSILSQDVERH--P 130
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  111 IPEDAMTGTAEMLFDYISECISDFLDKHQMKH-----KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGL 185
Cdd:PLN02362 131 IPQHLMNSTSEVLFDFIASSLKQFVEKEENGSefsqvRRRELGFTFSFPVKQTSISSGILIKWTKGFAISDMVGKDVAEC 210
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  186 LRDAIKRRGdFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEG---DEGRMCVNTEWGAFG 262
Cdd:PLN02362 211 LQGALNRRG-LDMRVAALVNDTVGTLALGHYHDPDTVAAVIIGTGTNACYLERTDAIIKCQGlltTSGSMVVNMEWGNFW 289
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  263 DSgELDEflLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFhGEASEQLRTRGAFETRFVSQV-ES 341
Cdd:PLN02362 290 SS-HLPR--TSYDIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMSQESDIF-GPVSSRLSTPFVLRTPSVAAMhED 365
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  342 DTGDRKQIYNIL-STLGLRPSTTDC-DIVRRACESVSTRAAHMCSAGLAGVINRMRE----------SRSEDVM--RITV 407
Cdd:PLN02362 366 DSPELQEVARILkETLGISEVPLKVrKLVVKICDVVTRRAARLAAAGIVGILKKIGRdgsggitsgrSRSDIQImrRTVV 445
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|.
gi 15967159  408 GVDGSVYKLHPSFKERFHASVRRL---TPSCEITFIESEEGSGRGAALVSA 455
Cdd:PLN02362 446 AVEGGLYTNYTMFREYLHEALNEIlgeDVAQHVILKATEDGSGIGSALLAA 496
PLN02596 PLN02596
hexokinase-like
1-455 2.30e-42

hexokinase-like


Pssm-ID: 178206  Cd Length: 490  Bit Score: 158.12  E-value: 2.30e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159    1 MAMDVTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKE----------------MDRGLRLETHEEASVKMLPTYVR 64
Cdd:PLN02596   8 VAATVATVAAVAAAVLMGRWKRRKERQWKHTQRILRKFAREcatpvsklwevadalvSDMTASLTAEETTTLNMLVSYVA 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   65 STPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEgqwSVKTKH-QMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHK 143
Cdd:PLN02596  88 SLPSGDEKGLYYGLNLRGSNFLLLRARLGGKNE---PISDLYrEEISIPSNVLNGTSQELFDYIALELAKFVAEHPGDEA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  144 KLP-----LGFTFSFPVRHEDIDKGILLNWtKGFKASGAEGNNVVGLLRDAIKRRGdFEMDVVAMVNDTVATMISCYYED 218
Cdd:PLN02596 165 DTPervkkLGFTVSYPVDQAAASSGSAIKW-KSFSADDTVGKALVNDINRALEKHG-LKIRVFALVDDTIGNLAGGRYYN 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  219 HQCEVGMIVGTGCNACYMEEMQNVELVEG---DEGRMCVNTEWGAFgDSGELDefLLEYDRLVDESSANPGQQLYEKLIG 295
Cdd:PLN02596 243 KDTVAAVTLGMGTNAAYVEPAQAIPKWQSpspESQEIVISTEWGNF-NSCHLP--ITEFDASLDAESSNPGSRIFEKLTS 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  296 GKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYN--ILSTLGLRPSTTDC-DIVRRAC 372
Cdd:PLN02596 320 GMYLGEIVRRVLLKMAEETALFGDTLPPKLTTPYLLRSPDMAAMHQDTSEDHEVVNekLKEIFGITDSTPMArEVVAEVC 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  373 ESVSTRAAHMCSAGLAGVINRMreSRSEDVMRItVGVDGSVYKLHPSFKERFHASVRRLTPS--CEITFIE-SEEGSGRG 449
Cdd:PLN02596 400 DIVAERGARLAGAGIVGIIKKL--GRIENKKSV-VTVEGGLYEHYRVFRNYLHSSVWEMLGSelSDNVVIEhSHGGSGAG 476

                 ....*.
gi 15967159  450 AALVSA 455
Cdd:PLN02596 477 ALFLAA 482
NBD_sugar-kinase_HSP70_actin cd00012
Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily ...
76-279 6.06e-18

Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; This superfamily includes the actin family, the HSP70 family of molecular chaperones and nucleotide exchange factors, the ROK (repressor, ORF, kinase) family, the hexokinase family, the FGGY family (which includes glycerol kinase and similar carbohydrate kinases such as rhamnulokinase and xylulokinase), the exopolyphosphatase/guanosine pentaphosphate phosphohydrolase/nucleoside triphosphate diphosphohydrolase family, propionate kinase/acetate kinase family, glycerol dehydratase reactivase, 2-hydroxyglutaryl-CoA dehydratase component A, N-acetylglucosamine kinase, butyrate kinase 2, Escherichia coli YeaZ and similar glycoproteases, the cell shape-determining protein MreB, the plasmid DNA segregation factor ParM, cell cycle proteins FtsA, Pili assembly protein PilM, ethanolamine utilization protein EutJ, and similar proteins. The nucleotide-binding site residues are conserved; the nucleotide sits in a deep cleft formed between the two lobes of the nucleotide-binding domain (NBD). Substrate binding to superfamily members is associated with closure of this catalytic site cleft. The functional activities of several members of the superfamily, including hexokinases, actin, and HSP70s, are modulated by allosteric effectors, which may act on the cleft closure.


Pssm-ID: 212657  Cd Length: 185  Bit Score: 82.25  E-value: 6.06e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  76 LSLDLGGTNFRVMLVKVGEGEEGQWSVKTkhqmySIPEDAMTGTAEMLFDYISECISDFLDkhQMKHKKLPLGFTFSFPV 155
Cdd:cd00012   1 LGIDIGSTSTKAGVADLDGEILPEEIVPT-----PVGRPGAVTDLDELEEALRELLKEALR--QLKSEIDAVGITEPGGV 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 156 RHEDIDKGILLNWtkgfkasgaegnnvvgLLRDAIKRRGDFEMDVVAMVNDTVATMISCYY--EDHQCEVGMIVGTG-CN 232
Cdd:cd00012  74 PKENREVIILPNL----------------LLIPLALALEDLGGVPVAVVNDAVAAALAEGLfgKEEDTVLVVDLGTGtTG 137
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 15967159 233 ACYMEEmqnvelvegDEGRMCVNTEWGAfgdSGELDEFLLEYDRLVD 279
Cdd:cd00012 138 IAIVED---------GKGGVGAAGELGI---AEALAAVLNLLDGLPD 172
PRK09698 PRK09698
D-allose kinase; Provisional
75-267 3.43e-06

D-allose kinase; Provisional


Pssm-ID: 182034  Cd Length: 302  Bit Score: 48.44  E-value: 3.43e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159   75 FLSLDLGGTNFRVMLVKvgegEEGQWSVKTKHQmysipedamtgTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFP 154
Cdd:PRK09698   6 VLGIDMGGTHIRFCLVD----AEGEILHCEKKR-----------TAEVIAPDLVSGLGEMIDEYLRRFNARCHGIVMGFP 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  155 --VrheDIDKGILLNwTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDV-VAMVNDTVAtmiscYYEDHQCEVGMIVGTGC 231
Cdd:PRK09698  71 alV---SKDRRTVIS-TPNLPLTALDLYDLADKLENTLNCPVFFSRDVnLQLLWDVKE-----NNLTQQLVLGAYLGTGM 141
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 15967159  232 -NACYMeemqnvelvegdEGRMCVntewGAFGDSGEL 267
Cdd:PRK09698 142 gFAVWM------------NGAPWT----GAHGVAGEL 162
NagC COG1940
Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain [Transcription, ...
75-233 3.09e-03

Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain [Transcription, Carbohydrate transport and metabolism];


Pssm-ID: 224851  Cd Length: 314  Bit Score: 39.39  E-value: 3.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159  75 FLSLDLGGTNFRVMLVKVGEGEEGQWSVKTkhqMYSIPEDAMTGTaemlfdyISECISDFLDKHQMKHKKLPLGFTFSFP 154
Cdd:COG1940   8 VLGIDIGGTKIKVALVDLDGEILLRERIPT---PTPDPEEAILEA-------ILALVAELLKQAQGRVAIIGIGIPGPGD 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15967159 155 VRHEDIDKGI-LLNWTKGFKasgaegnnvvglLRDAIKRRGDFEmdvVAMVNDTVATMIS-CYYEDHQCE---VGMIVGT 229
Cdd:COG1940  78 VDNGTVIVPApNLGWWNGVD------------LAEELEARLGLP---VFVENDANAAALAeAWFGAGRGIddvVYITLGT 142

                ....
gi 15967159 230 GCNA 233
Cdd:COG1940 143 GIGG 146
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH