NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|159469758|ref|XP_001693030|]
View 

eukaryotic initiation factor [Chlamydomonas reinhardtii]

Protein Classification

eIF-5_eIF-2B domain-containing protein (domain architecture ID 10486940)

eIF-5_eIF-2B domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
32-148 2.34e-52

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homolog. The region contains a putative zinc binding C4 finger.


:

Pssm-ID: 307814  Cd Length: 115  Bit Score: 165.74  E-value: 2.34e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758   32 ELTGERRRTVLKPPQVAREGTKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGQQRLIVKGRFLPKSFETVLRR 111
Cdd:pfam01873   1 DVTDSFYRYKMPPPQVKREGKGKTVIVNFSEIAKALNRDPEHVLKYLLKELGTQGSIDENGRLIINGKFSAKQIEDLLDK 80
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 159469758  112 YVNEYVLCPGCKSVDTLLDKDsaTRLMHLRCQQCGAS 148
Cdd:pfam01873  81 YIEEYVLCPECGSPDTELIKE--NRLLFLKCEACGAR 115
 
Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
32-148 2.34e-52

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homolog. The region contains a putative zinc binding C4 finger.


Pssm-ID: 307814  Cd Length: 115  Bit Score: 165.74  E-value: 2.34e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758   32 ELTGERRRTVLKPPQVAREGTKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGQQRLIVKGRFLPKSFETVLRR 111
Cdd:pfam01873   1 DVTDSFYRYKMPPPQVKREGKGKTVIVNFSEIAKALNRDPEHVLKYLLKELGTQGSIDENGRLIINGKFSAKQIEDLLDK 80
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 159469758  112 YVNEYVLCPGCKSVDTLLDKDsaTRLMHLRCQQCGAS 148
Cdd:pfam01873  81 YIEEYVLCPECGSPDTELIKE--NRLLFLKCEACGAR 115
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
37-148 1.02e-51

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 163.96  E-value: 1.02e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758    37 RRRTVLKPPQVAREGTKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGQQRLIVKGRFLPKSFETVLRRYVNEY 116
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|..
gi 159469758   117 VLCPGCKSVDTLLDKDsaTRLMHLRCQQCGAS 148
Cdd:smart00653  81 VLCPECGSPDTELIKE--NRLFFLKCEACGAR 110
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
12-154 6.06e-42

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 140.05  E-value: 6.06e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758  12 DYDYEELLERvfgiLREKNPELTGERRRTVLKPPQVAREGTKkTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGq 91
Cdd:PRK03988   4 YYDYEELLDR----AYEKLPEKVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNIEG- 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 159469758  92 QRLIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAI 154
Cdd:PRK03988  78 GRLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEG--RIWVLKCEACGAETPVKPL 138
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
10-164 3.07e-40

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 135.95  E-value: 3.07e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758  10 DRDYDYEELLERVFgilrEKNPELTGERR-RTVLKPPQVAREGtKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNL 88
Cdd:COG1601    3 EMEDDYEELLERAY----SELPEKEVKNDeRFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGSI 77
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 159469758  89 DGQQRLIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAIKAGFVARVTK 164
Cdd:COG1601   78 DGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEE--RLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
14-154 9.02e-27

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 100.31  E-value: 9.02e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758   14 DYEELLERVFgilrEKNPELTGERRRTVLKPPQVAREGTKkTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGqQR 93
Cdd:TIGR00311   1 DYEKLLERAI----DQLPDEVFETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEG-GR 74
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 159469758   94 LIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAI 154
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEG--RVSLLKCEACGAKAPLRNI 133
 
Name Accession Description Interval E-value
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
32-148 2.34e-52

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homolog. The region contains a putative zinc binding C4 finger.


Pssm-ID: 307814  Cd Length: 115  Bit Score: 165.74  E-value: 2.34e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758   32 ELTGERRRTVLKPPQVAREGTKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGQQRLIVKGRFLPKSFETVLRR 111
Cdd:pfam01873   1 DVTDSFYRYKMPPPQVKREGKGKTVIVNFSEIAKALNRDPEHVLKYLLKELGTQGSIDENGRLIINGKFSAKQIEDLLDK 80
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 159469758  112 YVNEYVLCPGCKSVDTLLDKDsaTRLMHLRCQQCGAS 148
Cdd:pfam01873  81 YIEEYVLCPECGSPDTELIKE--NRLLFLKCEACGAR 115
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
37-148 1.02e-51

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 163.96  E-value: 1.02e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758    37 RRRTVLKPPQVAREGTKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGQQRLIVKGRFLPKSFETVLRRYVNEY 116
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|..
gi 159469758   117 VLCPGCKSVDTLLDKDsaTRLMHLRCQQCGAS 148
Cdd:smart00653  81 VLCPECGSPDTELIKE--NRLFFLKCEACGAR 110
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
12-154 6.06e-42

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 140.05  E-value: 6.06e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758  12 DYDYEELLERvfgiLREKNPELTGERRRTVLKPPQVAREGTKkTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGq 91
Cdd:PRK03988   4 YYDYEELLDR----AYEKLPEKVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGNIEG- 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 159469758  92 QRLIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAI 154
Cdd:PRK03988  78 GRLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEG--RIWVLKCEACGAETPVKPL 138
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
10-164 3.07e-40

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 135.95  E-value: 3.07e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758  10 DRDYDYEELLERVFgilrEKNPELTGERR-RTVLKPPQVAREGtKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNL 88
Cdd:COG1601    3 EMEDDYEELLERAY----SELPEKEVKNDeRFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGSI 77
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 159469758  89 DGQQRLIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAIKAGFVARVTK 164
Cdd:COG1601   78 DGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEE--RLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
13-156 4.17e-36

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451  Cd Length: 201  Bit Score: 126.60  E-value: 4.17e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758  13 YDYEELLERVFgilrEKNPELTGERRRTVLKPPQVAREGtKKTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGqQ 92
Cdd:PRK12336   1 MDYESLLDRAM----EVLPEPTKSGERFSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEG-G 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 159469758  93 RLIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAIKA 156
Cdd:PRK12336  75 RAVFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKED--RVLMLRCDACGAHRPVKKRKA 136
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
14-154 9.02e-27

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 100.31  E-value: 9.02e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159469758   14 DYEELLERVFgilrEKNPELTGERRRTVLKPPQVAREGTKkTVFTNFMDLCKAMNRQHEHVSQYLLAELGTSGNLDGqQR 93
Cdd:TIGR00311   1 DYEKLLERAI----DQLPDEVFETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEG-GR 74
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 159469758   94 LIVKGRFLPKSFETVLRRYVNEYVLCPGCKSVDTLLDKDSatRLMHLRCQQCGASRTVQAI 154
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEG--RVSLLKCEACGAKAPLRNI 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH