NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15896920|ref|NP_350269|]
View 

membrane-associated methyl-accepting chemotaxis protein [Clostridium acetobutylicum ATCC 824]

Protein Classification

methyl-accepting chemotaxis protein (domain architecture ID 12007889)

methyl-accepting chemotaxis protein (MCP) is a bacterial receptor that mediates chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behavior

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
426-701 5.61e-61

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599  Cd Length: 262  Bit Score: 207.52  E-value: 5.61e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    426 DVANSIQNVAEGADSQLQISKDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSVKESN 505
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    506 STIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLIQQES 585
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    586 ADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIkgvtgvsetifshsEKVTTTVKEVRRIAGDFSTSAQEV 665
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLV--------------QEIAAATDEQAAGSEEVNAAIDEI 226
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 15896920    666 ATASQEELAAMEQVSSLASVLNKKADELELLIEKFK 701
Cdd:smart00283 227 AQVTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
HAMP pfam00672
HAMP domain;
324-391 1.10e-04

HAMP domain;


:

Pssm-ID: 307012  Cd Length: 69  Bit Score: 42.17  E-value: 1.10e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15896920   324 FVLLISVLTMLVLIYLFISFyqgIKGTIKLIEEGTSRIAEGKLDEgIVHDTKDETGLIVNALNNMLKS 391
Cdd:pfam00672   3 LVLLIALLLALLLAWLLARR---ILRPLRRLAEAARRIASGDLDV-PLESGRDEIGELARAFNQMAER 66
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
426-701 5.61e-61

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 207.52  E-value: 5.61e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    426 DVANSIQNVAEGADSQLQISKDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSVKESN 505
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    506 STIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLIQQES 585
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    586 ADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIkgvtgvsetifshsEKVTTTVKEVRRIAGDFSTSAQEV 665
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLV--------------QEIAAATDEQAAGSEEVNAAIDEI 226
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 15896920    666 ATASQEELAAMEQVSSLASVLNKKADELELLIEKFK 701
Cdd:smart00283 227 AQVTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
262-702 1.38e-60

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 211.39  E-value: 1.38e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 262 KSLINIINNELLNKSEITIDSEeyYNTATKTVEDIYSLIGNESSELMNALKLDNSFARNVRTFVLLISVLTMLVLIYLFI 341
Cdd:COG0840   1 SNLEAPLNLELIELAAGEADAG--LLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 342 SFYQGIKGTIKLIEEGTSRIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFSSMImaskdvssevinstQTLAKTTEETA 421
Cdd:COG0840  79 LLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQII--------------DAVQDNAEALS 144
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 422 NAANDVANSIQNVAEGADSQLQISKDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSV 501
Cdd:COG0840 145 GASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEEL 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 502 KEsnsTIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLI 581
Cdd:COG0840 225 AE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 582 QQESADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTVkevrriagdfsts 661
Cdd:COG0840 302 QNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASI------------- 368
                       410       420       430       440
                ....*....|....*....|....*....|....*....|.
gi 15896920 662 aQEVATASQEELAAMEQVSSLASVLNKKADELELLIEKFKV 702
Cdd:COG0840 369 -EELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
453-652 1.31e-53

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 184.75  E-value: 1.31e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 453 EKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSVKESNSTIYSLGEKSKNIGQIIDTITDIANET 532
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 533 NLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLIQQESADSISKMDVVTKNVNEGLKVVGEAGED 612
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 15896920 613 FKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTVKEVR 652
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
489-700 1.29e-45

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 162.62  E-value: 1.29e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   489 ETVSMMNNINNSVKESNSTIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSS 568
Cdd:pfam00015  10 EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSA 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   569 SSANKISEIIHLIQQESADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTV 648
Cdd:pfam00015  90 QAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAV 169
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 15896920   649 KEVRRIagdfstsaqevataSQEELAAMEQVSSLASVLNKKADELELLIEKF 700
Cdd:pfam00015 170 ARIDQV--------------TQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
328-681 1.30e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 114.72  E-value: 1.30e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  328 ISVLTMLVLIYLFISFYqGIKGT--------IKLIEEgtsrIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFSSMIMAS 399
Cdd:PRK15048 194 LAVIALVVVLILLVAWY-GIRRMlltplakiIAHIRE----IAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHV 268
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  400 KDVS-------SEVINSTQTLAKTTEETANAANDVANSIQN----VAEGADSQLQISKDAFEAiekmskdieyiaeqsnk 468
Cdd:PRK15048 269 REGSdaiyagtREIAAGNTDLSSRTEQQASALEETAASMEQltatVKQNADNARQASQLAQSA----------------- 331
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  469 vlfasnemNEFAIKGNESVLETVSMMNNINNSvkesnstiyslgekSKNIGQIIDTITDIANETNLLALNASIEAARAGE 548
Cdd:PRK15048 332 --------SDTAQHGGKVVDGVVKTMHEIADS--------------SKKIADIISVIDGIAFQTNILALNAAVEAARAGE 389
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  549 AGKGFSVVADEVRKLAEQSSSSANKISEIIHliqqesaDSISKmdvvtknVNEGLKVVGEAGEDFKKILEAIRSITDQIK 628
Cdd:PRK15048 390 QGRGFAVVAGEVRNLASRSAQAAKEIKALIE-------DSVSR-------VDTGSVLVESAGETMNNIVNAVTRVTDIMG 455
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15896920  629 GVTGVSETIFSHSEKVTTTVKEVRRIAGDFSTSAQEVATASqeelAAMEQVSS 681
Cdd:PRK15048 456 EIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAA----AALEEQAS 504
HAMP pfam00672
HAMP domain;
324-391 1.10e-04

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 42.17  E-value: 1.10e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15896920   324 FVLLISVLTMLVLIYLFISFyqgIKGTIKLIEEGTSRIAEGKLDEgIVHDTKDETGLIVNALNNMLKS 391
Cdd:pfam00672   3 LVLLIALLLALLLAWLLARR---ILRPLRRLAEAARRIASGDLDV-PLESGRDEIGELARAFNQMAER 66
Mtu_fam_mce TIGR00996
virulence factor Mce family protein; Members of this paralogous family are found as six tandem ...
518-700 3.32e-04

virulence factor Mce family protein; Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis]


Pssm-ID: 273384  Cd Length: 291  Bit Score: 43.04  E-value: 3.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   518 IGQIIDTITDIANETNLLALNASIEAARAGEAGKGfsvvaDEVRKLAEQSSSSANKISEIIHLIQQesadsiskmdvVTK 597
Cdd:TIGR00996 132 LDDLLGSLTRLLNGLDPEKLNAILNALAQALAGQG-----PQLRNLLDGLAQLTAALNERDGDIGE-----------LIR 195
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   598 NVNEGLKVVGEAGEDFKKILEAIRSITDQIKgvtgvsetifSHSEKVTTTVKEvrriAGDFSTSAQEVATASQEELA-AM 676
Cdd:TIGR00996 196 NLNRVLDVLADRSDQLDRLLDNLPTLIATLA----------DRSDALDDALAA----LSAASAQVRDLLAENRPNLGqAL 261
                         170       180
                  ....*....|....*....|....
gi 15896920   677 EQVSSLASVLNKKADELELLIEKF 700
Cdd:TIGR00996 262 ANLAPVLTLLVDYSPELEQLLHLL 285
 
Name Accession Description Interval E-value
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
426-701 5.61e-61

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 207.52  E-value: 5.61e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    426 DVANSIQNVAEGADSQLQISKDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSVKESN 505
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    506 STIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLIQQES 585
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920    586 ADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIkgvtgvsetifshsEKVTTTVKEVRRIAGDFSTSAQEV 665
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLV--------------QEIAAATDEQAAGSEEVNAAIDEI 226
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 15896920    666 ATASQEELAAMEQVSSLASVLNKKADELELLIEKFK 701
Cdd:smart00283 227 AQVTQETAAMSEEISAAAEELSGLAEELDELVERFK 262
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
262-702 1.38e-60

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 211.39  E-value: 1.38e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 262 KSLINIINNELLNKSEITIDSEeyYNTATKTVEDIYSLIGNESSELMNALKLDNSFARNVRTFVLLISVLTMLVLIYLFI 341
Cdd:COG0840   1 SNLEAPLNLELIELAAGEADAG--LLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 342 SFYQGIKGTIKLIEEGTSRIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFSSMImaskdvssevinstQTLAKTTEETA 421
Cdd:COG0840  79 LLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQII--------------DAVQDNAEALS 144
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 422 NAANDVANSIQNVAEGADSQLQISKDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSV 501
Cdd:COG0840 145 GASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEEL 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 502 KEsnsTIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLI 581
Cdd:COG0840 225 AE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 582 QQESADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTVkevrriagdfsts 661
Cdd:COG0840 302 QNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASI------------- 368
                       410       420       430       440
                ....*....|....*....|....*....|....*....|.
gi 15896920 662 aQEVATASQEELAAMEQVSSLASVLNKKADELELLIEKFKV 702
Cdd:COG0840 369 -EELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
453-652 1.31e-53

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 184.75  E-value: 1.31e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 453 EKMSKDIEYIAEQSNKVLFASNEMNEFAIKGNESVLETVSMMNNINNSVKESNSTIYSLGEKSKNIGQIIDTITDIANET 532
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920 533 NLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSSSSANKISEIIHLIQQESADSISKMDVVTKNVNEGLKVVGEAGED 612
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 15896920 613 FKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTVKEVR 652
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
489-700 1.29e-45

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 162.62  E-value: 1.29e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   489 ETVSMMNNINNSVKESNSTIYSLGEKSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEVRKLAEQSS 568
Cdd:pfam00015  10 EALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSA 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   569 SSANKISEIIHLIQQESADSISKMDVVTKNVNEGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSETIFSHSEKVTTTV 648
Cdd:pfam00015  90 QAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSAGIDQVNQAV 169
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 15896920   649 KEVRRIagdfstsaqevataSQEELAAMEQVSSLASVLNKKADELELLIEKF 700
Cdd:pfam00015 170 ARIDQV--------------TQQNAALVEESAAAAETLEEQAEELTASVAQF 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
328-681 1.30e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 114.72  E-value: 1.30e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  328 ISVLTMLVLIYLFISFYqGIKGT--------IKLIEEgtsrIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFSSMIMAS 399
Cdd:PRK15048 194 LAVIALVVVLILLVAWY-GIRRMlltplakiIAHIRE----IAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHV 268
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  400 KDVS-------SEVINSTQTLAKTTEETANAANDVANSIQN----VAEGADSQLQISKDAFEAiekmskdieyiaeqsnk 468
Cdd:PRK15048 269 REGSdaiyagtREIAAGNTDLSSRTEQQASALEETAASMEQltatVKQNADNARQASQLAQSA----------------- 331
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  469 vlfasnemNEFAIKGNESVLETVSMMNNINNSvkesnstiyslgekSKNIGQIIDTITDIANETNLLALNASIEAARAGE 548
Cdd:PRK15048 332 --------SDTAQHGGKVVDGVVKTMHEIADS--------------SKKIADIISVIDGIAFQTNILALNAAVEAARAGE 389
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  549 AGKGFSVVADEVRKLAEQSSSSANKISEIIHliqqesaDSISKmdvvtknVNEGLKVVGEAGEDFKKILEAIRSITDQIK 628
Cdd:PRK15048 390 QGRGFAVVAGEVRNLASRSAQAAKEIKALIE-------DSVSR-------VDTGSVLVESAGETMNNIVNAVTRVTDIMG 455
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 15896920  629 GVTGVSETIFSHSEKVTTTVKEVRRIAGDFSTSAQEVATASqeelAAMEQVSS 681
Cdd:PRK15048 456 EIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAA----AALEEQAS 504
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
326-681 1.37e-25

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 111.58  E-value: 1.37e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  326 LLISVLtmLVLIYLFISFYQGIKGTI-----KLIEEgTSRIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFSSMImask 400
Cdd:PRK15041 195 ILVGVM--IVVLAVIFAVWFGIKASLvapmnRLIDS-IRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTV---- 267
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  401 dvsSEVINSTQTLAKTTEETANAANDVANSIQNVAEGADsqlqiskDAFEAIEKMSKDIEYIAEQSNKVLFASNEMNEFA 480
Cdd:PRK15041 268 ---GDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLE-------ETAASMEQLTATVKQNAENARQASHLALSASETA 337
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  481 IKGNESVLETVSMMNNINNSvkesnstiyslgekSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSVVADEV 560
Cdd:PRK15041 338 QRGGKVVDNVVQTMRDISTS--------------SQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV 403
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  561 RKLAEQSSSSANKISEIIHliqqesaDSISKMDVvtknvneGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSETIFSH 640
Cdd:PRK15041 404 RNLAQRSAQAAREIKSLIE-------DSVGKVDV-------GSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRG 469
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|.
gi 15896920  641 SEKVTTTVKEVRRIAGDFSTSAQEVATASqeelAAMEQVSS 681
Cdd:PRK15041 470 IDQVGLAVAEMDRVTQQNAALVEESAAAA----AALEEQAS 506
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
316-689 2.31e-22

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 101.30  E-value: 2.31e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  316 SFARNVRTFVLLISVLTMLVLIYLFISfYQGIKGTIKLIEEGTSRIAEGKLDEGIVHDTKDETGLIVNALNNMLKSFssm 395
Cdd:PRK09793 184 NYQISALVFISMIIVAAIYISSALWWT-RKMIVQPLAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQAL--- 259
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  396 imasKDVSSEVINSTQTLAKTTEETANAANDVANSIQnvaEGADSQLQISKdafeAIEKMSKDIEYIAEQSNKVLFASNE 475
Cdd:PRK09793 260 ----RGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTE---QQAASLAQTAA----SMEQLTATVGQNADNARQASELAKN 328
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  476 MNEFAIKGNESVLETVSMMNNINNSvkesnstiyslgekSKNIGQIIDTITDIANETNLLALNASIEAARAGEAGKGFSV 555
Cdd:PRK09793 329 AATTAQAGGVQVSTMTHTMQEIATS--------------SQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAV 394
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920  556 VADEVRKLAeqsSSSANKISEIIHLIQQesadSISKmdvvtknVNEGLKVVGEAGEDFKKILEAIRSITDQIKGVTGVSE 635
Cdd:PRK09793 395 VAGEVRNLA---SRSAQAAKEIKGLIEE----SVNR-------VQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASE 460
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15896920  636 TIFSHSEKVTTTVKEVRRIAGDFSTSAQEVATASQEELAAMEQVSSLASVLNKK 689
Cdd:PRK09793 461 EQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVFTLE 514
HAMP pfam00672
HAMP domain;
324-391 1.10e-04

HAMP domain;


Pssm-ID: 307012  Cd Length: 69  Bit Score: 42.17  E-value: 1.10e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15896920   324 FVLLISVLTMLVLIYLFISFyqgIKGTIKLIEEGTSRIAEGKLDEgIVHDTKDETGLIVNALNNMLKS 391
Cdd:pfam00672   3 LVLLIALLLALLLAWLLARR---ILRPLRRLAEAARRIASGDLDV-PLESGRDEIGELARAFNQMAER 66
Mtu_fam_mce TIGR00996
virulence factor Mce family protein; Members of this paralogous family are found as six tandem ...
518-700 3.32e-04

virulence factor Mce family protein; Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis]


Pssm-ID: 273384  Cd Length: 291  Bit Score: 43.04  E-value: 3.32e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   518 IGQIIDTITDIANETNLLALNASIEAARAGEAGKGfsvvaDEVRKLAEQSSSSANKISEIIHLIQQesadsiskmdvVTK 597
Cdd:TIGR00996 132 LDDLLGSLTRLLNGLDPEKLNAILNALAQALAGQG-----PQLRNLLDGLAQLTAALNERDGDIGE-----------LIR 195
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896920   598 NVNEGLKVVGEAGEDFKKILEAIRSITDQIKgvtgvsetifSHSEKVTTTVKEvrriAGDFSTSAQEVATASQEELA-AM 676
Cdd:TIGR00996 196 NLNRVLDVLADRSDQLDRLLDNLPTLIATLA----------DRSDALDDALAA----LSAASAQVRDLLAENRPNLGqAL 261
                         170       180
                  ....*....|....*....|....
gi 15896920   677 EQVSSLASVLNKKADELELLIEKF 700
Cdd:TIGR00996 262 ANLAPVLTLLVDYSPELEQLLHLL 285
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH