NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15896629|ref|NP_349978|]
View 

methyl-accepting chemotaxis protein [Clostridium acetobutylicum ATCC 824]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl23763
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
216-381 4.22e-29

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 304920  Cd Length: 200  Bit Score: 113.10  E-value: 4.22e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 216 ASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEA 295
Cdd:cd11386  12 ASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAIEA 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 296 ARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSL 375
Cdd:cd11386  92 ARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEV 171

                ....*.
gi 15896629 376 TDISDN 381
Cdd:cd11386 172 ADGIQE 177
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
216-381 4.22e-29

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 113.10  E-value: 4.22e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 216 ASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEA 295
Cdd:cd11386  12 ASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAIEA 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 296 ARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSL 375
Cdd:cd11386  92 ARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEV 171

                ....*.
gi 15896629 376 TDISDN 381
Cdd:cd11386 172 ADGIQE 177
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
216-380 2.11e-27

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 109.68  E-value: 2.11e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    216 ASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEA 295
Cdd:smart00283  39 ANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEA 118
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    296 ARSGEAGRGFGIVAKEIRTLSTQT-------KDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEAL 368
Cdd:smart00283 119 ARAGEAGRGFAVVADEVRKLAERSaesakeiESLIKEIQEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEI 198
                          170
                   ....*....|..
gi 15896629    369 TNLSQSLTDISD 380
Cdd:smart00283 199 ADLVQEIAAATD 210
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
215-381 3.23e-23

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 99.68  E-value: 3.23e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 215 KASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIE 294
Cdd:COG0840 183 KEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIE 262
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 295 AARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQS 374
Cdd:COG0840 263 AARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEE 342

                ....*..
gi 15896629 375 LTDISDN 381
Cdd:COG0840 343 VSQLISE 349
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
247-380 4.79e-18

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 82.11  E-value: 4.79e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629   247 SQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQTKDTViki 326
Cdd:pfam00015  16 SQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAA--- 92
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 15896629   327 KEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSLTDISD 380
Cdd:pfam00015  93 KEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIAD 146
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
239-380 4.97e-14

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 73.18  E-value: 4.97e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629  239 AQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQ 318
Cdd:PRK09793 326 AKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 405
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15896629  319 TKDTvikikefTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSLTDISD 380
Cdd:PRK09793 406 SAQA-------AKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASE 460
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
217-382 3.82e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 39.27  E-value: 3.82e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    217 SAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIE-----------KISEVISDI----- 280
Cdd:TIGR02168  230 LVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEelqkelyalanEISRLEQQKqilre 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    281 ---SAQTNILGINASIE--AARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQT 355
Cdd:TIGR02168  310 rlaNLERQLEELEAQLEelESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVA 389
                          170       180
                   ....*....|....*....|....*..
gi 15896629    356 AATEEITSSIEALTNLSQSLTDISDNL 382
Cdd:TIGR02168  390 QLELQIASLNNEIERLEARLERLEDRR 416
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
216-381 4.22e-29

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 113.10  E-value: 4.22e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 216 ASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEA 295
Cdd:cd11386  12 ASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAIEA 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 296 ARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSL 375
Cdd:cd11386  92 ARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEV 171

                ....*.
gi 15896629 376 TDISDN 381
Cdd:cd11386 172 ADGIQE 177
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
216-380 2.11e-27

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599  Cd Length: 262  Bit Score: 109.68  E-value: 2.11e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    216 ASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEA 295
Cdd:smart00283  39 ANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEA 118
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    296 ARSGEAGRGFGIVAKEIRTLSTQT-------KDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEAL 368
Cdd:smart00283 119 ARAGEAGRGFAVVADEVRKLAERSaesakeiESLIKEIQEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEI 198
                          170
                   ....*....|..
gi 15896629    369 TNLSQSLTDISD 380
Cdd:smart00283 199 ADLVQEIAAATD 210
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
215-381 3.23e-23

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 99.68  E-value: 3.23e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 215 KASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIE 294
Cdd:COG0840 183 KEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIE 262
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 295 AARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQS 374
Cdd:COG0840 263 AARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEE 342

                ....*..
gi 15896629 375 LTDISDN 381
Cdd:COG0840 343 VSQLISE 349
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
247-380 4.79e-18

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444  Cd Length: 207  Bit Score: 82.11  E-value: 4.79e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629   247 SQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQTKDTViki 326
Cdd:pfam00015  16 SQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAA--- 92
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 15896629   327 KEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSLTDISD 380
Cdd:pfam00015  93 KEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVEAVAEIAD 146
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
239-380 4.97e-14

methyl-accepting protein IV; Provisional


Pssm-ID: 182079  Cd Length: 533  Bit Score: 73.18  E-value: 4.97e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629  239 AQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQ 318
Cdd:PRK09793 326 AKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 405
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15896629  319 TKDTvikikefTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSLTDISD 380
Cdd:PRK09793 406 SAQA-------AKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASE 460
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
258-380 8.78e-14

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001  Cd Length: 554  Bit Score: 72.68  E-value: 8.78e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629  258 EDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQTkdtvikiKEFTQNIKEAV 337
Cdd:PRK15041 349 QTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRS-------AQAAREIKSLI 421
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 15896629  338 EETNNRSD--KTLASSQEQTAAteEITSSIEALTNLSQSLTDISD 380
Cdd:PRK15041 422 EDSVGKVDvgSTLVESAGETMA--EIVSAVTRVTDIMGEIASASD 464
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
260-379 4.29e-13

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008  Cd Length: 553  Bit Score: 70.42  E-value: 4.29e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629  260 IKRIYELSEGIEKISEVIS---DISAQTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQTkdtvikiKEFTQNIKEA 336
Cdd:PRK15048 346 VKTMHEIADSSKKIADIISvidGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS-------AQAAKEIKAL 418
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 15896629  337 VEETNNRSDktlASSQEQTAATEEITSSIEALTNLSQSLTDIS 379
Cdd:PRK15048 419 IEDSVSRVD---TGSVLVESAGETMNNIVNAVTRVTDIMGEIA 458
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
221-377 5.25e-04

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 41.51  E-value: 5.25e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 221 VKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIEKISEVISDISAQTNILGINASIEAARSGE 300
Cdd:COG0840  35 KLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDE 114
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15896629 301 agrgFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQTAATEEITSSIEALTNLSQSLTD 377
Cdd:COG0840 115 ----FGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAF 187
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
207-341 8.22e-04

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910  Cd Length: 408  Bit Score: 41.13  E-value: 8.22e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629 207 GSFGIIIPKASAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDI----KRIYELSEGIEKISEVISDISA 282
Cdd:COG0840 101 GDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASAtelsARADQQAESLEEVASAIEELSE 180
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15896629 283 QTNILGINASIEAARSGEAGRGFGIVAKEIRTLSTQTKDTVI--------------KIKEFTQNIKEAVEETN 341
Cdd:COG0840 181 TVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEelaevvkklsessqEIEEITSVINSIAEQTN 253
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
217-382 3.82e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 39.27  E-value: 3.82e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    217 SAKKVKDASRDLNEGLVSIEAAAQELAATSSQINTSEMELSEDIKRIYELSEGIE-----------KISEVISDI----- 280
Cdd:TIGR02168  230 LVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEelqkelyalanEISRLEQQKqilre 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15896629    281 ---SAQTNILGINASIE--AARSGEAGRGFGIVAKEIRTLSTQTKDTVIKIKEFTQNIKEAVEETNNRSDKTLASSQEQT 355
Cdd:TIGR02168  310 rlaNLERQLEELEAQLEelESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVA 389
                          170       180
                   ....*....|....*....|....*..
gi 15896629    356 AATEEITSSIEALTNLSQSLTDISDNL 382
Cdd:TIGR02168  390 QLELQIASLNNEIERLEARLERLEDRR 416
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH