NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15895004|ref|NP_348353|]
View 

Ser/Thr phosphatase [Clostridium acetobutylicum ATCC 824]

Protein Classification

serine/threonine-protein phosphatase (domain architecture ID 10001918)

serine/threonine-protein phosphatase catalyzes the dephosphorylation of phosphoserine and phosphothreonine residues of specific protein substrates

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
15-269 3.72e-84

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


:

Pssm-ID: 223704  Cd Length: 262  Bit Score: 256.13  E-value: 3.72e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  15 VKGNNMKMVGMLSDIGTVRKLNEDYVGYYENDDIR---FYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYE-LG 90
Cdd:COG0631   2 SSGILSLKVAGLSDVGTVRKHNEDAFLIKPNENGNlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsLE 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  91 DVLSSAIKFANEQIYRKSKASDGLSGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITE 170
Cdd:COG0631  82 ELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITP 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004 171 KEALSHPNKNIITRALGTGEDVDVDIFDVTLNDVSKGILATDGLTNVVDTREIYNIVLENDN-MVACQKLIELSKDKGSR 249
Cdd:COG0631 162 EEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETpQEAADKLIELALEGGGP 241
                       250       260
                ....*....|....*....|
gi 15895004 250 DNISVIVFEGECKDDRNCAK 269
Cdd:COG0631 242 DNITVVLVRLNGEGETSRDY 261
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
15-269 3.72e-84

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 256.13  E-value: 3.72e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  15 VKGNNMKMVGMLSDIGTVRKLNEDYVGYYENDDIR---FYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYE-LG 90
Cdd:COG0631   2 SSGILSLKVAGLSDVGTVRKHNEDAFLIKPNENGNlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsLE 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  91 DVLSSAIKFANEQIYRKSKASDGLSGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITE 170
Cdd:COG0631  82 ELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITP 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004 171 KEALSHPNKNIITRALGTGEDVDVDIFDVTLNDVSKGILATDGLTNVVDTREIYNIVLENDN-MVACQKLIELSKDKGSR 249
Cdd:COG0631 162 EEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETpQEAADKLIELALEGGGP 241
                       250       260
                ....*....|....*....|
gi 15895004 250 DNISVIVFEGECKDDRNCAK 269
Cdd:COG0631 242 DNITVVLVRLNGEGETSRDY 261
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
22-256 5.04e-62

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 199.09  E-value: 5.04e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  22 MVGMLSDIGTVRKLNEDYVGYYEN---DDIRFYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYELGDVLSSAIK 98
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIKPNlnnEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  99 FANEQIYRKSKASDGLSGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITEKEALS--- 175
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRVSngr 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004 176 HPNKNIITRALG-----TGEDVDVDIFDVTL-NDVSKGILATDGLTNVVDTREIYNIVLENDN----MVACQKLIELSKD 245
Cdd:cd00143 161 VPGVLAVTRALGdfdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSELAkedlQEAAQELVDLALR 240
                       250
                ....*....|.
gi 15895004 246 KGSRDNISVIV 256
Cdd:cd00143 241 RGSHDNITVVV 251
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
26-256 6.04e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.87  E-value: 6.04e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004     26 LSDIGTVRKLNEDYVGYY--ENDDIRFYVVADGMGGHNAGEVASKLAVDStVKYIKEINNINLYELGDVLSSAIKFANEQ 103
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITpdLSDSGGFFGVFDGHGGSEAAKFLSKNLPEI-LAEELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    104 IYRKSKAsdglsGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITEKEALS---HPNKN 180
Cdd:smart00332  92 ILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFVIngrVNGVL 166
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    181 IITRALGtgeDVDV--------DIFDVTLNDvsKG---ILATDGLTNVVDTREIYNIV---LENDNMVACQKLIELSKDK 246
Cdd:smart00332 167 ALSRAIG---DFFLkpyvsaepDVTVVELTE--KDdflILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALAR 241
                          250
                   ....*....|
gi 15895004    247 GSRDNISVIV 256
Cdd:smart00332 242 GSKDNITVVV 251
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
27-256 2.38e-31

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756  Cd Length: 645  Bit Score: 123.24  E-value: 2.38e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   27 SDIGTVRKLNEDYVG------YYENDDIR------FYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYElGDVLS 94
Cdd:PRK14559 381 TDVGRQRHHNEDYFGintriqKLENPHGRivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQDELPD-EETIR 459
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   95 SAIKFANEQIYRK--SKASDGLSGMGTTITACLIKDKDAVVANVGDSSCY-FIKRDDIIKITKDHSLVQQLVDNGtITEK 171
Cdd:PRK14559 460 EAIYLANEAIYDLnqQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG-VEPQ 538
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  172 EALSHPNKNIITRALGTGED--VDVDIFDVTLNDVSKGILATDGLTNvvdtreiyNIVLEND------NMVACQ------ 237
Cdd:PRK14559 539 IAYARPDAYQLTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLSD--------NDLLETHwqthllPLLSSSanldqg 610
                        250       260
                 ....*....|....*....|.
gi 15895004  238 --KLIELSKDKGSRDNISVIV 256
Cdd:PRK14559 611 lnKLIDLANQYNGHDNITAIL 631
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
45-252 8.74e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 77.00  E-value: 8.74e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    45 NDDIRFYVVADGMGGHNAGEVASKLAVDstvkyikEINNINLYELGDVLSSAIK--FANEQIYRKSKASDGLSGMGTTIT 122
Cdd:pfam00481  31 KDSRSFFAVFDGHGGSEAAKYCGKHLHT-------ILALRRSFLGLEKLEDALRksFLEDTDEVLRSAEKEDLSSGCTAV 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   123 ACLIKDKDAVVANVGDSSCYFIKRDDIIK-ITKDHslvqqLVDNgtITEKEALSH-----PNKNII------TRALGtge 190
Cdd:pfam00481 104 VALISGNKLYVANVGDSRAVLCRNGNAIKrLTKDH-----KPSD--EDERRRIRAaggfvSRNGRVngvlavSRAFG--- 173
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15895004   191 DVDVDIF--------DVTLNDVSKG----ILATDGLTNVVDTREI-----YNIVLENDNMVACQKLIELSKDKGSRDNI 252
Cdd:pfam00481 174 DFELKPGeqpvsaepDITSHTITEDdeflILACDGLWDVLSDQEVvdlvrSELSDGGSPMEAAEELRDEAIAYGSEDNI 252
 
Name Accession Description Interval E-value
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
15-269 3.72e-84

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 256.13  E-value: 3.72e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  15 VKGNNMKMVGMLSDIGTVRKLNEDYVGYYENDDIR---FYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYE-LG 90
Cdd:COG0631   2 SSGILSLKVAGLSDVGTVRKHNEDAFLIKPNENGNlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsLE 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  91 DVLSSAIKFANEQIYRKSKASDGLSGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITE 170
Cdd:COG0631  82 ELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITP 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004 171 KEALSHPNKNIITRALGTGEDVDVDIFDVTLNDVSKGILATDGLTNVVDTREIYNIVLENDN-MVACQKLIELSKDKGSR 249
Cdd:COG0631 162 EEARSHPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETpQEAADKLIELALEGGGP 241
                       250       260
                ....*....|....*....|
gi 15895004 250 DNISVIVFEGECKDDRNCAK 269
Cdd:COG0631 242 DNITVVLVRLNGEGETSRDY 261
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
22-256 5.04e-62

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 199.09  E-value: 5.04e-62
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  22 MVGMLSDIGTVRKLNEDYVGYYEN---DDIRFYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYELGDVLSSAIK 98
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIKPNlnnEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  99 FANEQIYRKSKASDGLSGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITEKEALS--- 175
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRVSngr 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004 176 HPNKNIITRALG-----TGEDVDVDIFDVTL-NDVSKGILATDGLTNVVDTREIYNIVLENDN----MVACQKLIELSKD 245
Cdd:cd00143 161 VPGVLAVTRALGdfdlkPGVSAEPDVTVVKLtEDDDFLILASDGLWDVLSNQEAVDIVRSELAkedlQEAAQELVDLALR 240
                       250
                ....*....|.
gi 15895004 246 KGSRDNISVIV 256
Cdd:cd00143 241 RGSHDNITVVV 251
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
26-256 6.04e-33

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 122.87  E-value: 6.04e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004     26 LSDIGTVRKLNEDYVGYY--ENDDIRFYVVADGMGGHNAGEVASKLAVDStVKYIKEINNINLYELGDVLSSAIKFANEQ 103
Cdd:smart00332  13 LSSMQGVRKPMEDAHVITpdLSDSGGFFGVFDGHGGSEAAKFLSKNLPEI-LAEELIKEKDELEDVEEALRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    104 IYRKSKAsdglsGMGTTITACLIKDKDAVVANVGDSSCYFIKRDDIIKITKDHSLVQQLVDNGTITEKEALS---HPNKN 180
Cdd:smart00332  92 ILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFVIngrVNGVL 166
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    181 IITRALGtgeDVDV--------DIFDVTLNDvsKG---ILATDGLTNVVDTREIYNIV---LENDNMVACQKLIELSKDK 246
Cdd:smart00332 167 ALSRAIG---DFFLkpyvsaepDVTVVELTE--KDdflILASDGLWDVLSNQEVVDIVrkhLSKDPKEAAKRLIDLALAR 241
                          250
                   ....*....|
gi 15895004    247 GSRDNISVIV 256
Cdd:smart00332 242 GSKDNITVVV 251
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
27-256 2.38e-31

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756  Cd Length: 645  Bit Score: 123.24  E-value: 2.38e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   27 SDIGTVRKLNEDYVG------YYENDDIR------FYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNINLYElGDVLS 94
Cdd:PRK14559 381 TDVGRQRHHNEDYFGintriqKLENPHGRivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHWQDELPD-EETIR 459
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   95 SAIKFANEQIYRK--SKASDGLSGMGTTITACLIKDKDAVVANVGDSSCY-FIKRDDIIKITKDHSLVQQLVDNGtITEK 171
Cdd:PRK14559 460 EAIYLANEAIYDLnqQNARSGSGRMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG-VEPQ 538
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004  172 EALSHPNKNIITRALGTGED--VDVDIFDVTLNDVSKGILATDGLTNvvdtreiyNIVLEND------NMVACQ------ 237
Cdd:PRK14559 539 IAYARPDAYQLTQALGPRDNsaIQPDIQFLEIEEDTLLLLCSDGLSD--------NDLLETHwqthllPLLSSSanldqg 610
                        250       260
                 ....*....|....*....|.
gi 15895004  238 --KLIELSKDKGSRDNISVIV 256
Cdd:PRK14559 611 lnKLIDLANQYNGHDNITAIL 631
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
38-230 3.77e-17

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 77.39  E-value: 3.77e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004     38 DYVGYYENDDIR-FYVVADGMGGHNAGEVASKLAVDSTVKYIKEinninlyelGDVLSSAIKFANEQIYRKskasdGLSG 116
Cdd:smart00331  19 DFYDVVKLPEGRlLIAIADVMGKGLAAALAMSMARSALRTLLSE---------GISLSQILERLNRAIYEN-----GEDG 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    117 MGTTITACLIKDKD--AVVANVGDSSCYFIKRDDIIKITKDHSlvqqlvdngtitekealshpnkniiTRALGTGEDVDV 194
Cdd:smart00331  85 MFATLFLALYDFAGgtLSYANAGHSPPYLLRADGGLVEDLDDL-------------------------GAPLGLEPDVEV 139
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 15895004    195 DIFDVTLNDVSKGILATDGLTNVVDTREIYNIVLEN 230
Cdd:smart00331 140 DVRELTLEPGDLLLLYTDGLTEARNPERLEELLEEL 175
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
45-252 8.74e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 77.00  E-value: 8.74e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    45 NDDIRFYVVADGMGGHNAGEVASKLAVDstvkyikEINNINLYELGDVLSSAIK--FANEQIYRKSKASDGLSGMGTTIT 122
Cdd:pfam00481  31 KDSRSFFAVFDGHGGSEAAKYCGKHLHT-------ILALRRSFLGLEKLEDALRksFLEDTDEVLRSAEKEDLSSGCTAV 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   123 ACLIKDKDAVVANVGDSSCYFIKRDDIIK-ITKDHslvqqLVDNgtITEKEALSH-----PNKNII------TRALGtge 190
Cdd:pfam00481 104 VALISGNKLYVANVGDSRAVLCRNGNAIKrLTKDH-----KPSD--EDERRRIRAaggfvSRNGRVngvlavSRAFG--- 173
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15895004   191 DVDVDIF--------DVTLNDVSKG----ILATDGLTNVVDTREI-----YNIVLENDNMVACQKLIELSKDKGSRDNI 252
Cdd:pfam00481 174 DFELKPGeqpvsaepDITSHTITEDdeflILACDGLWDVLSDQEVvdlvrSELSDGGSPMEAAEELRDEAIAYGSEDNI 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
36-222 2.09e-12

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 316216  Cd Length: 209  Bit Score: 64.27  E-value: 2.09e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004    36 NEDYVGYYENDDIRFYVVADGMGGHNAGEVASKLAVDSTVKYIKEINNiNLYELGDVLSSAIKFANEQIYRKSKASDGLS 115
Cdd:pfam13672  12 CQDAFAVWVLDGGWLIAVADGAGSAKRSDVGARIAVEAAVEALADLLE-SEEELIEALLRAILNDWLALVKAEALAQDLE 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   116 G--MGTTITACLIKDKDAVVANVGDSSCYFIKRDDIikitkdhslVQQL--VDNG-------TITEKEALSHPNKNIitr 184
Cdd:pfam13672  91 PrdYATTLLAAVVTPGGIVFFQIGDGAIVVRDRDGE---------VQVLsqPDSGeyanettFLTSEDALDELRIRR--- 158
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 15895004   185 algtgedvdvdifdVTLNDVSKGILATDGLTNVVDTRE 222
Cdd:pfam13672 159 --------------LPLEPGDALALMTDGLANSLRDEE 182
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
50-156 1.88e-05

Protein phosphatase 2c; Provisional


Pssm-ID: 215603  Cd Length: 365  Bit Score: 45.29  E-value: 1.88e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15895004   50 FYVVADGMGGHNAGEVASKlavdSTVKYIKEINNINLyELGDVLSSAIkFANEQIYRKSKASDGLSGMGTTITACLIKDK 129
Cdd:PLN03145 105 FYGVFDGHGGKHAADFACY----HLPRFIVEDEDFPR-EIEKVVSSAF-LQTDTAFAEACSLDASLASGTTALAALVVGR 178
                         90       100
                 ....*....|....*....|....*..
gi 15895004  130 DAVVANVGDSSCYFIKRDDIIKITKDH 156
Cdd:PLN03145 179 SLVVANAGDCRAVLCRRGKAIEMSRDH 205
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH