NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|158341642|ref|NP_036739|]
View 

neurofilament heavy polypeptide [Rattus norvegicus]

Protein Classification

Filament and Neuromodulin_N domain-containing protein (domain architecture ID 11981715)

Filament and Neuromodulin_N domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
96-412 1.02e-110

Intermediate filament protein;


:

Pssm-ID: 306535  Cd Length: 313  Bit Score: 349.60  E-value: 1.02e-110
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642    96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQ-AGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHL 174
Cdd:pfam00038    1 NEKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKgAEPSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   175 LEDIAHVRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGELLGQIQgcgaaQAQ 254
Cdd:pfam00038   81 RLAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQ-----DTQ 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   255 AQAEARDALKCDVTSALREIRAQLEGHTVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEA 334
Cdd:pfam00038  156 VNVEMDAARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQS 235
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642   335 LKSTKESLERQRSELEDRHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412
Cdd:pfam00038  236 LKKQKASLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
Neuromodulin_N super family cl26511
Gap junction protein N-terminal region;
495-1064 1.52e-31

Gap junction protein N-terminal region;


The actual alignment was detected with superfamily member PTZ00121:

Pssm-ID: 331332  Cd Length: 2084  Bit Score: 134.11  E-value: 1.52e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  495 TTSPPAEEAASPEKETKSpvKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PTZ00121 1106 TETGKAEEARKAEEAKKK--AEDARKAEEARKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARK 1183
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAE-AKSPAEVKSPATVKSPVEAKSP 653
Cdd:PTZ00121 1184 AEEVRKAEELRKAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEeAKKAEEERNNEEIRKFEEARMA 1263
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  654 AEVKSPVTVKSpAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPA--------EAKSPAEA--KPPAEAK 723
Cdd:PTZ00121 1264 HFARRQAAIKA-EEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKAdeakkkaeEAKKKADAakKKAEEAK 1342
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  724 SPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSpEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMK 803
Cdd:PTZ00121 1343 KAAEAAKAEAEAAADEAEAAEEKAEAAEKKK-EEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAKKKAD 1421
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  804 EEAKSPEKAKTLD--VKSPEAKTPAKEEAKRPADIRSPEQVKSPAKE-----EAKSPEKEETRTEKVAPKKEEVKSPVEE 876
Cdd:PTZ00121 1422 EAKKKAEEKKKADeaKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEakkadEAKKKAEEAKKADEAKKKAEEAKKKADE 1501
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  877 VKAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQK-PKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLG 955
Cdd:PTZ00121 1502 AKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEaKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALR 1581
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  956 VKEEAKPKEKA-----------EDAKAKEPSKPSEKEKPKKEEVPAAPEKKdtKEEKTTESKKPEEKPKMEAKAKEEdkg 1024
Cdd:PTZ00121 1582 KAEEAKKAEEArieevmklyeeEKKMKAEEAKKAEEAKIKAEELKKAEEEK--KKVEQLKKKEAEEKKKAEELKKAE--- 1656
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|
gi 158341642 1025 lpqEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKAAKGDK 1064
Cdd:PTZ00121 1657 ---EENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEA 1693
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
96-412 1.02e-110

Intermediate filament protein;


Pssm-ID: 306535  Cd Length: 313  Bit Score: 349.60  E-value: 1.02e-110
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642    96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQ-AGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHL 174
Cdd:pfam00038    1 NEKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKgAEPSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   175 LEDIAHVRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGELLGQIQgcgaaQAQ 254
Cdd:pfam00038   81 RLAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQ-----DTQ 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   255 AQAEARDALKCDVTSALREIRAQLEGHTVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEA 334
Cdd:pfam00038  156 VNVEMDAARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQS 235
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642   335 LKSTKESLERQRSELEDRHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412
Cdd:pfam00038  236 LKKQKASLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
PTZ00121 PTZ00121
MAEBL; Provisional
495-1064 1.52e-31

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 134.11  E-value: 1.52e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  495 TTSPPAEEAASPEKETKSpvKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PTZ00121 1106 TETGKAEEARKAEEAKKK--AEDARKAEEARKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARK 1183
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAE-AKSPAEVKSPATVKSPVEAKSP 653
Cdd:PTZ00121 1184 AEEVRKAEELRKAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEeAKKAEEERNNEEIRKFEEARMA 1263
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  654 AEVKSPVTVKSpAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPA--------EAKSPAEA--KPPAEAK 723
Cdd:PTZ00121 1264 HFARRQAAIKA-EEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKAdeakkkaeEAKKKADAakKKAEEAK 1342
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  724 SPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSpEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMK 803
Cdd:PTZ00121 1343 KAAEAAKAEAEAAADEAEAAEEKAEAAEKKK-EEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAKKKAD 1421
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  804 EEAKSPEKAKTLD--VKSPEAKTPAKEEAKRPADIRSPEQVKSPAKE-----EAKSPEKEETRTEKVAPKKEEVKSPVEE 876
Cdd:PTZ00121 1422 EAKKKAEEKKKADeaKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEakkadEAKKKAEEAKKADEAKKKAEEAKKKADE 1501
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  877 VKAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQK-PKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLG 955
Cdd:PTZ00121 1502 AKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEaKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALR 1581
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  956 VKEEAKPKEKA-----------EDAKAKEPSKPSEKEKPKKEEVPAAPEKKdtKEEKTTESKKPEEKPKMEAKAKEEdkg 1024
Cdd:PTZ00121 1582 KAEEAKKAEEArieevmklyeeEKKMKAEEAKKAEEAKIKAEELKKAEEEK--KKVEQLKKKEAEEKKKAEELKKAE--- 1656
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|
gi 158341642 1025 lpqEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKAAKGDK 1064
Cdd:PTZ00121 1657 ---EENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEA 1693
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
114-409 6.49e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 69.70  E-value: 6.49e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   114 KVRQLEAHNRSLEGEAAALRQQQAGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDEEARQRE 193
Cdd:TIGR02168  685 KIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIE 764
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   194 EAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGEL-LGQIQGCGAAQAQAQAEARDALKCDVTSALR 272
Cdd:TIGR02168  765 ELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELtLLNEEAANLRERLESLERRIAATERRLEDLE 844
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   273 EIRAQLEGHTVQSTLQSEEwFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKESLERQRSELEDR 352
Cdd:TIGR02168  845 EQIEELSEDIESLAAEIEE-LEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREK 923
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642   353 hqvdMASYQDAIQQLDNELRNTKwemaAQLRE-YQDLLNVKMALDIEIAAYRKLLEGE 409
Cdd:TIGR02168  924 ----LAQLELRLEGLEVRIDNLQ----ERLSEeYSLTLEEAEALENKIEDDEEEARRR 973
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
99-410 1.25e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 55.88  E-value: 1.25e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   99 EQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQagraamgelyerevREMRGAVLRLGAARGQLRLEQEHLLEDI 178
Cdd:COG1196   674 EELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQL--------------EELERQLEELKRELAALEEELEQLQSRL 739
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  179 AHVRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEEcgylRRHHQEEVGELLGQIQgcgaaqaqaqae 258
Cdd:COG1196   740 EELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEK----RQALQEELEELEEELE------------ 803
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  259 ardalkcdvtsalreiRAQLEGHTVQSTLQSEEwfrVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKST 338
Cdd:COG1196   804 ----------------EAERRLDALERELESLE---QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEE 864
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158341642  339 KESLERQRSELED---RHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEE 410
Cdd:COG1196   865 LEELEAEKEELEDelkELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEY 939
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
548-899 2.28e-07

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904  Cd Length: 886  Bit Score: 54.92  E-value: 2.28e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   548 AKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGeakSPAEAKSPAEVKSPVEAKSPAEAkSPASvKSPGEAK 627
Cdd:pfam05109  422 SKAPESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPA---STGPTVSTADVTSPTPAGTTSGA-SPVT-PSPSPRD 496
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   628 SPAEAKSPAEVKSPATVKSPV-EAKSPAEVkspVTVKSPAEAKSPVEVKSPAS-VKSPS---EAKSPAGAKSPAEAKSPV 702
Cdd:pfam05109  497 NGTESKAPDMTSPTSAVTTPTpNATSPTPA---VTTPTPNATSPTLGKTSPTSaVTTPTpnaTSPTPAVTTPTPNATIPT 573
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   703 VAKSpaeAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSpAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSP- 781
Cdd:pfam05109  574 LGKT---SPTSAVTTPTPNATSPTVGETSPQANTTNHTLG-GTSSTPVVTSPPKNATSAVTTGQHNITSSSTSSMSLRPs 649
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   782 -VKEEIKPPAEVKSpeKAKSPMKEEAKsPEKAKTLDVKSPEAKTPAKEEAKRPADirspeqvKSPAKEEAKSPEKEETRT 860
Cdd:pfam05109  650 sISETLSPSTSDNS--TSHMPLLTSAH-PTGGENITQVTPASTSTHHVSTSSPAP-------RPGTTSQASGPGNSSTST 719
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 158341642   861 ekvapKKEEVKspveeVKAKEPPKKVEEEKTPATPKTEV 899
Cdd:pfam05109  720 -----KPGEVN-----VTKGTPPKNATSPQAPSGQKTAV 748
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
691-920 1.05e-05

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273344  Cd Length: 1096  Bit Score: 49.61  E-value: 1.05e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   691 GAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKS----PAEAKSPAEAKSPAEAKSP-----VEVKSPEKAKSP 761
Cdd:TIGR00927  642 GERTGEEGERPTEAEGENGEESGGEAEQEGETETKGENESegeiPAERKGEQEGEGEIEAKEAdhkgeTEAEEVEHEGET 721
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   762 VKEGAKSLAEAKSPEKAKSpVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQ 841
Cdd:TIGR00927  722 EAEGTEDEGEIETGEEGEE-VEDEGEGEAEGKHEVETEGDRKETEHEGETEAEGKEDEDEGEIQAGEDGEMKGDEGAEGK 800
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   842 VKSPAKEEAKSPEKEETRTEKVAPkKEEVKSPVEEV--------KAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQK 913
Cdd:TIGR00927  801 VEHEGETEAGEKDEHEGQSETQAD-DTEVKDETGEQelnaenqgEAKQDEKGVDGGGGSDGGDSEEEEEEEEEEEEEEEE 879

                   ....*..
gi 158341642   914 PKAEEKE 920
Cdd:TIGR00927  880 EEEEEEE 886
PRK11281 PRK11281
hypothetical protein; Provisional
240-408 3.04e-04

hypothetical protein; Provisional


Pssm-ID: 236892  Cd Length: 1113  Bit Score: 44.90  E-value: 3.04e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  240 ELLGQIQgcgaaqaqAQAEARDALKCDVTSA---LREIRAQLEghTVQSTLQSEEwfRVRLDRLSEA---AKVN--TDAM 311
Cdd:PRK11281   70 ALLDKID--------RQKEETEQLKQQLAQApakLRQAQAELE--ALKDDNDEET--RETLSTLSLRqleSRLAqtLDQL 137
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  312 RSAQEEITEYRRQLQARTTELEalkstkeslerqrseledRHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNV 391
Cdd:PRK11281  138 QNAQNDLAEYNSQLVSLQTQPE------------------RAQAALYANSQRLQQIRNLLKGGKVGGKALRPSQRVLLQA 199
                         170
                  ....*....|....*...
gi 158341642  392 KMA-LDIEIAAYRKLLEG 408
Cdd:PRK11281  200 EQAlLNAQNDLQRKSLEG 217
COG5373 COG5373
Uncharacterized membrane protein [Function unknown];
498-575 1.31e-03

Uncharacterized membrane protein [Function unknown];


Pssm-ID: 227665  Cd Length: 931  Bit Score: 42.50  E-value: 1.31e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642  498 PPAEEAASPEKETKSPVKEEAKSPAEAKSPAEaksPAEAKSPAEVKSPAVAksPAEVKSPAEVKSPAEAKSPAEAKSP 575
Cdd:COG5373    49 KAAEQMAAPEAAEAAPLPAAAESIASPEVPPP---VPPAPAQEGEAPAAEQ--PSAVPAPSAAPAPAEPVEPSLAANP 121
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
96-412 1.02e-110

Intermediate filament protein;


Pssm-ID: 306535  Cd Length: 313  Bit Score: 349.60  E-value: 1.02e-110
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642    96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQ-AGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHL 174
Cdd:pfam00038    1 NEKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKgAEPSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   175 LEDIAHVRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGELLGQIQgcgaaQAQ 254
Cdd:pfam00038   81 RLAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQ-----DTQ 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   255 AQAEARDALKCDVTSALREIRAQLEGHTVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEA 334
Cdd:pfam00038  156 VNVEMDAARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQS 235
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642   335 LKSTKESLERQRSELEDRHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412
Cdd:pfam00038  236 LKKQKASLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
PTZ00121 PTZ00121
MAEBL; Provisional
495-1064 1.52e-31

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 134.11  E-value: 1.52e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  495 TTSPPAEEAASPEKETKSpvKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PTZ00121 1106 TETGKAEEARKAEEAKKK--AEDARKAEEARKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARK 1183
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAE-AKSPAEVKSPATVKSPVEAKSP 653
Cdd:PTZ00121 1184 AEEVRKAEELRKAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEeAKKAEEERNNEEIRKFEEARMA 1263
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  654 AEVKSPVTVKSpAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPA--------EAKSPAEA--KPPAEAK 723
Cdd:PTZ00121 1264 HFARRQAAIKA-EEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKAdeakkkaeEAKKKADAakKKAEEAK 1342
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  724 SPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSpEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMK 803
Cdd:PTZ00121 1343 KAAEAAKAEAEAAADEAEAAEEKAEAAEKKK-EEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAKKKAD 1421
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  804 EEAKSPEKAKTLD--VKSPEAKTPAKEEAKRPADIRSPEQVKSPAKE-----EAKSPEKEETRTEKVAPKKEEVKSPVEE 876
Cdd:PTZ00121 1422 EAKKKAEEKKKADeaKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEakkadEAKKKAEEAKKADEAKKKAEEAKKKADE 1501
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  877 VKAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQK-PKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLG 955
Cdd:PTZ00121 1502 AKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEaKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALR 1581
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  956 VKEEAKPKEKA-----------EDAKAKEPSKPSEKEKPKKEEVPAAPEKKdtKEEKTTESKKPEEKPKMEAKAKEEdkg 1024
Cdd:PTZ00121 1582 KAEEAKKAEEArieevmklyeeEKKMKAEEAKKAEEAKIKAEELKKAEEEK--KKVEQLKKKEAEEKKKAEELKKAE--- 1656
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|
gi 158341642 1025 lpqEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKAAKGDK 1064
Cdd:PTZ00121 1657 ---EENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEA 1693
PTZ00121 PTZ00121
MAEBL; Provisional
437-1064 1.00e-28

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 124.87  E-value: 1.00e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  437 KVKSEEKIKVVEKSEKETVIVEE--QTEEIQVTEEVTEEEDKEAQGEEEEEAEEGGEEAATTSPPAEEAASPEKETKSPV 514
Cdd:PTZ00121 1110 KAEEARKAEEAKKKAEDARKAEEarKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARKAEEVRK 1189
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  515 KEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEakspaEAKSPAEVKSPATVKSPGEAKSPA 594
Cdd:PTZ00121 1190 AEELRKAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAE-----EAKKAEEERNNEEIRKFEEARMAH 1264
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  595 EAKSPAEVKSPvEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPV-EAKSPAE---VKSPVTVKSPAEAKS 670
Cdd:PTZ00121 1265 FARRQAAIKAE-EARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKAdEAKKKAEeakKKADAAKKKAEEAKK 1343
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  671 PVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPA-EAKSPAE--AKSPAEAKSPAEAKSPAEak 747
Cdd:PTZ00121 1344 AAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAEEKKKAdEAKKKAEedKKKADELKKAAAAKKKAD-- 1421
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  748 spvEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSP--MKEEAKSPEKAKTLDVKSPEAKTP 825
Cdd:PTZ00121 1422 ---EAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEAKKAdeAKKKAEEAKKADEAKKKAEEAKKK 1498
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  826 A-----KEEAKRPADIRSPEQVKSPAKEEAKSPEK---------EETRTEKVAPKKEEVKSpVEEVKAKEPPKKVEEEKT 891
Cdd:PTZ00121 1499 AdeakkAAEAKKKADEAKKAEEAKKADEAKKAEEAkkadeakkaEEKKKADELKKAEELKK-AEEKKKAEEAKKAEEDKN 1577
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  892 PATPKTEVKESKKDEAPKEAQKPKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLGVKEEAKPKEKAEDAKA 971
Cdd:PTZ00121 1578 MALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAEE 1657
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  972 KEPSKPSEKEKPKKEEVPAAPEKKDTKEEKTTES----KKPEEKPKMEA--KAKEEDKGLPQEPSKPKTEKAEKSSSTDQ 1045
Cdd:PTZ00121 1658 ENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAealkKEAEEAKKAEElkKKEAEEKKKAEELKKAEEENKIKAEEAKK 1737
                         650
                  ....*....|....*....
gi 158341642 1046 KDSQPSEKAPEDKAAKGDK 1064
Cdd:PTZ00121 1738 EAEEDKKKAEEAKKDEEEK 1756
PTZ00121 PTZ00121
MAEBL; Provisional
507-1061 8.30e-28

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 122.17  E-value: 8.30e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  507 EKETKSPVKEEAKSPAEakspaEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKS 586
Cdd:PTZ00121 1085 EDNRADEATEEAFGKAE-----EAKKTETGKAEEARKAEEAKKKAEDARKAEEARKAEDARKAEEARKAEDAKRVEIARK 1159
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  587 PGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPA 666
Cdd:PTZ00121 1160 AEDARKAEEARKAEDAKKAEAARKAEEVRKAEELRKAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDA 1239
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  667 E-AKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSpvvakspAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAE 745
Cdd:PTZ00121 1240 EeAKKAEEERNNEEIRKFEEARMAHFARRQAAIKA-------EEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAE 1312
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  746 akspvEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTlDVKSPEAKTP 825
Cdd:PTZ00121 1313 -----EAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEA-KKKADAAKKK 1386
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  826 AKEEAKRPADIRSPEQVKSPAkEEAKSPEKEETRTEKVAPKKEEVKspveevKAKEPPKKVEEEKTPATPKTEVKESKKD 905
Cdd:PTZ00121 1387 AEEKKKADEAKKKAEEDKKKA-DELKKAAAAKKKADEAKKKAEEKK------KADEAKKKAEEAKKADEAKKKAEEAKKA 1459
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  906 EAPKEaqkpKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLGVKEEAKPKE--KAEDAKAKEPSKPSEKEKP 983
Cdd:PTZ00121 1460 EEAKK----KAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEakKAEEAKKADEAKKAEEAKK 1535
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642  984 KKEEVPAAPEKKDTKEEKTTESKKPEEKPKMEAKAKEEDKGLPQEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKAAK 1061
Cdd:PTZ00121 1536 ADEAKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAK 1613
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
422-907 5.32e-27

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628  Cd Length: 943  Bit Score: 118.64  E-value: 5.32e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  422 LTEGLPKIPSMSTHIKVKSEEKIKVVEKSEKETVIVEEQ-TEEIQVTEEVTEEE-------DKEAQGEEEEEAEEGGEEA 493
Cdd:PTZ00449  442 VSDGAARLVHLRIKDRIPANNDIYMLKFDEYWTRISKIQfTQEIKKLIKKSKKKlapieeeDSDKHDEPPEGPEASGLPP 521
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  494 atTSPPAEEAASPEKETkspvKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPaevKSPAEAKSPAEAK 573
Cdd:PTZ00449  522 --KAPGDKEGEEGEHED----SKESDEPKEGGKPGETKEGEVGKKPGPAKEHKPSKIPTLSKKP---EFPKDPKHPKDPE 592
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  574 SPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSP 653
Cdd:PTZ00449  593 EPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRPESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSPKPPFDPKFK 672
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  654 AEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEakPPAEAKSPaeAKSPAE 733
Cdd:PTZ00449  673 EKFYDDYLDAAAKSKETKTTVVLDESFESILKETLPETPGTPFTTPRPLPPKLPRDEEFPFE--PIGDPDAE--QPDDIE 748
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  734 AKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEgAKSLAEAKSPEKA----KSPVKEEIKPPAEVKSpekakSPMKEEAKSP 809
Cdd:PTZ00449  749 FFTPPEEERTFFHETPADTPLPDILAEEFKE-EDIHAETGEPDEAmkrpDSPSEHEDKPPGDHPS-----LPKKRHRLDG 822
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  810 EKAKTLDVKSpEAKTPAKEEAKRPAD------------IRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSpveEV 877
Cdd:PTZ00449  823 LALSTTDLES-DAGRIAKDASGKIVKlkrsksfddlttVEEAEEMGAEARKIVVDDDGTEADDEDTHPPEEKHKS---EV 898
                         490       500       510
                  ....*....|....*....|....*....|
gi 158341642  878 KAKEPPKKVEEEKTPATPKtevKESKKDEA 907
Cdd:PTZ00449  899 RRRRPPKKPSKPKKPSKPK---KPKKPDSA 925
PTZ00121 PTZ00121
MAEBL; Provisional
437-1047 2.02e-26

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 117.55  E-value: 2.02e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  437 KVKSEEKIKVVEKSEKETVIVE-EQTEEIQVTEEVTEEEDKEAQGEEEEEAEEGGEEAATTSPPAEEAASPEKETKSPVK 515
Cdd:PTZ00121 1207 KAEEERKAEEARKAEDAKKAEAvKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKA 1286
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  516 EEAKSPAEAKSPAEAKSPAEAKSPAEVKSPA-VAKSPAEvksPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPA 594
Cdd:PTZ00121 1287 EEKKKADEAKKAEEKKKADEAKKKAEEAKKAdEAKKKAE---EAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAE 1363
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  595 EAKSPAEVKSPVEAKSPAEAKSPAS-VKSPGEAKSPAE--AKSPAEVKSPATVKSPVE--AKSPAEVKSPVTVKSPAEAK 669
Cdd:PTZ00121 1364 EKAEAAEKKKEEAKKKADAAKKKAEeKKKADEAKKKAEedKKKADELKKAAAAKKKADeaKKKAEEKKKADEAKKKAEEA 1443
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  670 SpvevKSPASVKSPSEAKSPAGAKSPAEAKspvvaKSPAEAKSPAEAKPPA-EAKSPAE--AKSPAEAKSPAEAKSPA-E 745
Cdd:PTZ00121 1444 K----KADEAKKKAEEAKKAEEAKKKAEEA-----KKADEAKKKAEEAKKAdEAKKKAEeaKKKADEAKKAAEAKKKAdE 1514
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  746 AKSPVEVKSPEKAKSpvKEGAKSLAEAKSPEKAKSpvKEEIKPPAEVKSPEKAKSpmKEEAKSPEKAKTLDVKSPEAKTP 825
Cdd:PTZ00121 1515 AKKAEEAKKADEAKK--AEEAKKADEAKKAEEKKK--ADELKKAEELKKAEEKKK--AEEAKKAEEDKNMALRKAEEAKK 1588
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  826 AkEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVApKKEEVKSPVEEVKAKEppkkvEEEKTPATPKTEVKESKKD 905
Cdd:PTZ00121 1589 A-EEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELK-KAEEEKKKVEQLKKKE-----AEEKKKAEELKKAEEENKI 1661
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  906 EAPKEAQKPKaEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLGVKEEAKPKEKAEDAKAKEPSKPSEKEKPKK 985
Cdd:PTZ00121 1662 KAAEEAKKAE-EDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAE 1740
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158341642  986 EEVPAAPEKKDTKEEKTTESKKPEEKPKMEAKAKEEDKGLPQEPSKPKTEKAEKSSSTDQKD 1047
Cdd:PTZ00121 1741 EDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKEKEAVIEEELDEEDEKRRMEVDKKIKD 1802
PTZ00121 PTZ00121
MAEBL; Provisional
261-918 1.83e-22

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 104.45  E-value: 1.83e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  261 DALKCDVTSALREIRAQLEGHTVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRsaqeeITEYRRQLQARTTELEALKSTKE 340
Cdd:PTZ00121 1174 DAKKAEAARKAEEVRKAEELRKAEDARKAEAARKAEEERKAEEARKAEDAKK-----AEAVKKAEEAKKDAEEAKKAEEE 1248
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  341 SLERQRSELEDRHQVDMASYQDAIqqldnelrntKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPSPF 420
Cdd:PTZ00121 1249 RNNEEIRKFEEARMAHFARRQAAI----------KAEEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEAKKAD 1318
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  421 SLTEGLPKIPSMSTHIKVKSEEKIKVVEKSEKETvivEEQTEEIQVTEEVTEEEDKEAQGEEEEEAEEGGEEAATTSppA 500
Cdd:PTZ00121 1319 EAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEA---EAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAEEKKK--A 1393
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  501 EEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEakspaEVKSPAVAKSPAEVKSPAEvkspaEAKSPAEAKSPAEvks 580
Cdd:PTZ00121 1394 DEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAE-----EKKKADEAKKKAEEAKKAD-----EAKKKAEEAKKAE--- 1460
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  581 pATVKSPGEAKSPAEAKSPAEvkspvEAKSPAEAKSPA--SVKSPGEAKSPAEAKSPAEvkspatvkspvEAKSPAEVKS 658
Cdd:PTZ00121 1461 -EAKKKAEEAKKADEAKKKAE-----EAKKADEAKKKAeeAKKKADEAKKAAEAKKKAD-----------EAKKAEEAKK 1523
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  659 PVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKppAEAKSPAEAKSPAEAKSPA 738
Cdd:PTZ00121 1524 ADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRK--AEEAKKAEEARIEEVMKLY 1601
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  739 EAKSPAEAKspvEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPE-----KAK 813
Cdd:PTZ00121 1602 EEEKKMKAE---EAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAeedkkKAE 1678
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  814 TLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPA 893
Cdd:PTZ00121 1679 EAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKK 1758
                         650       660
                  ....*....|....*....|....*
gi 158341642  894 TPKTEVKESKKDEAPKEAQKPKAEE 918
Cdd:PTZ00121 1759 IAHLKKEEEKKAEEIRKEKEAVIEE 1783
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
547-993 1.91e-19

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628  Cd Length: 943  Bit Score: 94.37  E-value: 1.91e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  547 VAKSPAEVKSPAEVKSPAEAKSPaeaKSPAEVKSPATvkSPGEAKSPAEAKSPA-EVKSPVEAKSPAEAKSPASVKSPGE 625
Cdd:PTZ00449  489 IKKSKKKLAPIEEEDSDKHDEPP---EGPEASGLPPK--APGDKEGEEGEHEDSkESDEPKEGGKPGETKEGEVGKKPGP 563
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  626 AKSPAEAKSPAEVKSPATVKSPveaKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAK 705
Cdd:PTZ00449  564 AKEHKPSKIPTLSKKPEFPKDP---KHPKDPEEPKKPKRPRSAQRPTRPKSPKLPELLDIPKSPKRPESPKSPKRPPPPQ 640
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  706 SPAEAKSPAEAKPPAEAKSPAEAKSPAEaksPAEAKSPAEAKSPVEVKSPE-KAKSPVKEGAKSLAEAKSPEKAKSPVKE 784
Cdd:PTZ00449  641 RPSSPERPEGPKIIKSPKPPKSPKPPFD---PKFKEKFYDDYLDAAAKSKEtKTTVVLDESFESILKETLPETPGTPFTT 717
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  785 EIK-PPAEVKSPEKAKSPMKEeaksPEKAKTLDVkspEAKTPAKEEAKR----PADIRSP----EQVKSP-AKEEAKSPE 854
Cdd:PTZ00449  718 PRPlPPKLPRDEEFPFEPIGD----PDAEQPDDI---EFFTPPEEERTFfhetPADTPLPdilaEEFKEEdIHAETGEPD 790
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  855 KEETRTEkvAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATP-KTEVKESKKDEAPKEAQKPKAEEKEPLT---EKPKDSP 930
Cdd:PTZ00449  791 EAMKRPD--SPSEHEDKPPGDHPSLPKKRHRLDGLALSTTDlESDAGRIAKDASGKIVKLKRSKSFDDLTtveEAEEMGA 868
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 158341642  931 GEAKKEEAKEKKAAAPEEETPAKlgvkeeakPKEKAEDAKAKEPSKPSEKEKPKKEEVPAAPE 993
Cdd:PTZ00449  869 EARKIVVDDDGTEADDEDTHPPE--------EKHKSEVRRRRPPKKPSKPKKPSKPKKPKKPD 923
PHA03247 PHA03247
large tegument protein UL36; Provisional
498-931 1.26e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 79.21  E-value: 1.26e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  498 PPAEEAASPEKETKS-PVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPA 576
Cdd:PHA03247 2553 PPLPPAAPPAAPDRSvPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPS 2632
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  577 ----EVKSPATVKSPgEAKSPAEAKSPAEVKSPVEAKSPAEAKSPAS-VKSPGEAKSPAEAKSPAEVKSPATVKSPVEAK 651
Cdd:PHA03247 2633 paanEPDPHPPPTVP-PPERPRDDPAPGRVSRPRRARRLGRAAQASSpPQRPRRRAARPTVGSLTSLADPPPPPPTPEPA 2711
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  652 SPAEVKSPVTVKSPAEAK--SPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAeakSPAEAK 729
Cdd:PHA03247 2712 PHALVSATPLPPGPAAARqaSPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRR---LTRPAV 2788
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  730 SPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEikPPAEVKSPEKAKSPMKEEAKSP 809
Cdd:PHA03247 2789 ASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPG--PPPPSLPLGGSVAPGGDVRRRP 2866
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  810 EKAKTLDVKSPEAKTPAKEEAkRPADIRSPEQVKSPAKEEAKSPEKEetrtekvapkkeevkspveevkAKEPPKKVEEE 889
Cdd:PHA03247 2867 PSRSPAAKPAAPARPPVRRLA-RPAVSRSTESFALPPDQPERPPQPQ----------------------APPPPQPQPQP 2923
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|..
gi 158341642  890 KTPATPKTEVKESKKDEAPKEAQKPKAEEKEPLTEKPKDSPG 931
Cdd:PHA03247 2924 PPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLG 2965
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
609-1053 1.81e-14

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628  Cd Length: 943  Bit Score: 78.19  E-value: 1.81e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  609 KSPAEAKSPAsvKSPGEAKSPAEAKSPA-EVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPasvKSPSEAK 687
Cdd:PTZ00449  512 EGPEASGLPP--KAPGDKEGEEGEHEDSkESDEPKEGGKPGETKEGEVGKKPGPAKEHKPSKIPTLSKKP---EFPKDPK 586
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  688 SPAGAKSPAEAKSPVVAKSPAEAKSPaeaKPPAEAKSPAEAKSPAEAKSPaeaKSPAEAKSPVEVKSPEKAKSPvkegak 767
Cdd:PTZ00449  587 HPKDPEEPKKPKRPRSAQRPTRPKSP---KLPELLDIPKSPKRPESPKSP---KRPPPPQRPSSPERPEGPKII------ 654
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  768 slaeaKSPEKAKSPvkeeiKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAkrpadirspeqvkspak 847
Cdd:PTZ00449  655 -----KSPKPPKSP-----KPPFDPKFKEKFYDDYLDAAAKSKETKTTVVLDESFESILKETL----------------- 707
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  848 eeAKSPEKEETRTEKVAPKKeevksPVEEVKAKEPPKKveeektPATPKTEvkeskkdeaPKEAQKPKAEEKEPLTEKPK 927
Cdd:PTZ00449  708 --PETPGTPFTTPRPLPPKL-----PRDEEFPFEPIGD------PDAEQPD---------DIEFFTPPEEERTFFHETPA 765
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  928 DSPgeakkeeakekkaaapEEETPAKLGVKEEAKPKEKAEDAKAKEPSKPSEKEKPKKEEVPAAPEKKDTKEE---KTTE 1004
Cdd:PTZ00449  766 DTP----------------LPDILAEEFKEEDIHAETGEPDEAMKRPDSPSEHEDKPPGDHPSLPKKRHRLDGlalSTTD 829
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 158341642 1005 --------SKKPEEKPKMEAKAKEEDKGLPQEPSKPKTEKAEK------SSSTDQKDSQPSEK 1053
Cdd:PTZ00449  830 lesdagriAKDASGKIVKLKRSKSFDDLTTVEEAEEMGAEARKivvdddGTEADDEDTHPPEE 892
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
528-788 2.70e-12

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 71.03  E-value: 2.70e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  528 AEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKsPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVE 607
Cdd:PRK07003  372 VPARVAGAVPAPGARAAAAVGASAVPAVTAVTGA-AGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  608 AKSPAeaksPASVKSPGEAKSPAEAKSPAEVKSPAtvkSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEak 687
Cdd:PRK07003  451 AKANA----RASADSRCDERDAQPPADSGSASAPA---SDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAAASREDA-- 521
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  688 sPAGAKSPAEAKSPvvaKSPAEAKSPAEAKPPAEA--------------KSPAEAKSPAEAKSPAEAKSPAEAKSPVEVK 753
Cdd:PRK07003  522 -PAAAAPPAPEARP---PTPAAAAPAARAGGAAAAldvlrnagmrvssdRGARAAAAAKPAAAPAAAPKPAAPRVAVQVP 597
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 158341642  754 SPEKAKSPVKEGAKSLAEAKSPEKAK--SPVKEEIKP 788
Cdd:PRK07003  598 TPRARAATGDAPPNGAARAEQAAESRgaPPPWEDIPP 634
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
498-805 6.09e-12

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039  Cd Length: 1352  Bit Score: 70.20  E-value: 6.09e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  498 PPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAevkSPAEAKSPAEAKSPAE 577
Cdd:PHA03307  118 PPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSS---PEETARAPSSPPAEPP 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  578 VKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPA-----EAKSPASVKSPGEAKSPAEA---KSPAEVKSPATVKSPVE 649
Cdd:PHA03307  195 PSTPPAAASPRPPRRSSPISASASSPAPAPGRSAAddagaSSSDSSSSESSGCGWGPENEcplPRPAPITLPTRIWEASG 274
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  650 AKSPAEVKSPVTVKSPAEAKSPvevKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAK 729
Cdd:PHA03307  275 WNGPSSRPGPASSSSSPRERSP---SPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESSRGAAVSPGPSPSRSP 351
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 158341642  730 SPAEAKSPAEAKSPAEAKSPVEV---KSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEE 805
Cdd:PHA03307  352 SPSRPPPPADPSSPRKRPRPSRApssPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGAFYARY 430
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
114-409 6.49e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 69.70  E-value: 6.49e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   114 KVRQLEAHNRSLEGEAAALRQQQAGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDEEARQRE 193
Cdd:TIGR02168  685 KIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIE 764
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   194 EAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGEL-LGQIQGCGAAQAQAQAEARDALKCDVTSALR 272
Cdd:TIGR02168  765 ELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELtLLNEEAANLRERLESLERRIAATERRLEDLE 844
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   273 EIRAQLEGHTVQSTLQSEEwFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKESLERQRSELEDR 352
Cdd:TIGR02168  845 EQIEELSEDIESLAAEIEE-LEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREK 923
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642   353 hqvdMASYQDAIQQLDNELRNTKwemaAQLRE-YQDLLNVKMALDIEIAAYRKLLEGE 409
Cdd:TIGR02168  924 ----LAQLELRLEGLEVRIDNLQ----ERLSEeYSLTLEEAEALENKIEDDEEEARRR 973
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
497-749 9.54e-12

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 69.11  E-value: 9.54e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  497 SPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPA 576
Cdd:PRK07003  382 APGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADS 461
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  577 EVKSPAtvkspgeaksPAEAKSPAEVKSPVEAKSPAEAKSPAsvkSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEV 656
Cdd:PRK07003  462 RCDERD----------AQPPADSGSASAPASDAPPDAAFEPA---PRAAAPSAATPAAVPDARAPAAASREDAPAAAAPP 528
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  657 KSPVTVKSPAEAKSP---------VEVKSPASVKSPSE-AKSPAGAKSPAEAkspvvaksPAEAKSPAEAKPPAEAKSPA 726
Cdd:PRK07003  529 APEARPPTPAAAAPAaraggaaaaLDVLRNAGMRVSSDrGARAAAAAKPAAA--------PAAAPKPAAPRVAVQVPTPR 600
                         250       260
                  ....*....|....*....|...
gi 158341642  727 EAKSPAEAKSPAEAKSPAEAKSP 749
Cdd:PRK07003  601 ARAATGDAPPNGAARAEQAAESR 623
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
566-749 2.44e-11

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 67.95  E-value: 2.44e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  566 AKSPAEAKSPAEVksPATVKSPGEAKSPAEAKSPAEVKSPVEAKsPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVK 645
Cdd:PRK07003  364 GGGAPGGGVPARV--AGAVPAPGARAAAAVGASAVPAVTAVTGA-AGAALAPKAAAAAAATRAEAPPAAPAPPATADRGD 440
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  646 SPVEAKSPAEVKSPVtvksPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPA---EAKSPVVAKSPAEAKSPAEAKPPAEA 722
Cdd:PRK07003  441 DAADGDAPVPAKANA----RASADSRCDERDAQPPADSGSASAPASDAPPDaafEPAPRAAAPSAATPAAVPDARAPAAA 516
                         170       180
                  ....*....|....*....|....*..
gi 158341642  723 KSPAEAKSPAEAKSPAEAKSPAEAKSP 749
Cdd:PRK07003  517 SREDAPAAAAPPAPEARPPTPAAAAPA 543
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
538-770 4.97e-11

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 66.82  E-value: 4.97e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  538 SPAEVKSPAVAkSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAK-SPAEAKSPAEVKSPVEAKSPAEAKS 616
Cdd:PRK12323  373 GPATAAAAPVA-QPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARrSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  617 PASVKSPGEAKSPAEAKSPAevkspatvkSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPA 696
Cdd:PRK12323  452 PAPAAAPAAAARPAAAGPRP---------VAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWV 522
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 158341642  697 EAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKS-PEKAKS-PVKEGAKSLA 770
Cdd:PRK12323  523 AESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFDGDwPALAARlPVRGLAQQLA 598
PHA03247 PHA03247
large tegument protein UL36; Provisional
498-846 6.97e-10

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 63.42  E-value: 6.97e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  498 PPAEEAASPEKETKSPVKEEAKSPAEAKS---PAEAKSPAEAKSPAEVKsPAVAKSPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PHA03247 2641 HPPPTVPPPERPRDDPAPGRVSRPRRARRlgrAAQASSPPQRPRRRAAR-PTVGSLTSLADPPPPPPTPEPAPHALVSAT 2719
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 P-------AEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSP 647
Cdd:PHA03247 2720 PlppgpaaARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLP 2799
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  648 VeAKSPAEVKSPVTVKSPAE--AKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSP 725
Cdd:PHA03247 2800 S-PWDPADPPAAVLAPAAALppAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAP 2878
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  726 AEaksPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPvkegaKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAkSPMKEE 805
Cdd:PHA03247 2879 AR---PPVRRLARPAVSRSTESFALPPDQPERPPQP-----QAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPL-APTTDP 2949
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|.
gi 158341642  806 AKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPA 846
Cdd:PHA03247 2950 AGAGEPSGAVPQPWLGALVPGRVAVPRFRVPQPAPSREAPA 2990
PHA03247 PHA03247
large tegument protein UL36; Provisional
498-795 7.84e-10

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 63.42  E-value: 7.84e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  498 PPAEEaasPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAE 577
Cdd:PHA03247 2701 PPPPP---PTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAA 2777
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  578 VKSPATVKSPGEAKSPAEAKSPAevkSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVK-SPATVKSPVEAKSPAE- 655
Cdd:PHA03247 2778 GPPRRLTRPAVASLSESRESLPS---PWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPtAPPPPPGPPPPSLPLGg 2854
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  656 ---VKSPVTVKSPAEAKSPVevksPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPA 732
Cdd:PHA03247 2855 svaPGGDVRRRPPSRSPAAK----PAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQ 2930
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158341642  733 EA-KSPAEAKSP-AEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSP 795
Cdd:PHA03247 2931 PPpPPPPRPQPPlAPTTDPAGAGEPSGAVPQPWLGALVPGRVAVPRFRVPQPAPSREAPASSTPP 2995
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
496-696 8.56e-10

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 62.59  E-value: 8.56e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  496 TSPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAK-SPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PRK12323  372 AGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARrSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKS---PAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAK 651
Cdd:PRK12323  452 PAPAAAPAAAARPAAAGPrpvAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPAT 531
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 158341642  652 SPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPA 696
Cdd:PRK12323  532 ADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDM 576
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
500-862 1.13e-09

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039  Cd Length: 1352  Bit Score: 62.50  E-value: 1.13e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  500 AEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSP-----AEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PHA03307   14 AAEGGEFFPRPPATPGDAADDLLSGSQGQLVSDSAELAAVTVVAGAAACDRFepptgPPPGPGTEAPANESRSTPTWSLS 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPA 654
Cdd:PHA03307   94 TLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAA 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  655 EVKSpvtvKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAeAKPPAEAKSPAEAKSPAEA 734
Cdd:PHA03307  174 LPLS----SPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAA-DDAGASSSDSSSSESSGCG 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  735 KSPaEAKSPAEAKSPVEVKSPEKAKSPVKEGA--KSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKA 812
Cdd:PHA03307  249 WGP-ENECPLPRPAPITLPTRIWEASGWNGPSsrPGPASSSSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSS 327
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 158341642  813 KTLDVKSPEAKT-----PAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEK 862
Cdd:PHA03307  328 STSSSSESSRGAavspgPSPSRSPSPSRPPPPADPSSPRKRPRPSRAPSSPAASA 382
PLN03237 PLN03237
DNA topoisomerase 2; Provisional
507-801 1.82e-09

DNA topoisomerase 2; Provisional


Pssm-ID: 215641  Cd Length: 1465  Bit Score: 61.80  E-value: 1.82e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  507 EKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAvAKSPAEVKSPAEvKSPAEAKSPAEAKSPAEVKSPATVKS 586
Cdd:PLN03237 1162 EKELDKLDKEDAKAEEAREKLQRAAARGESGAAKKVSRQA-PKKPAPKKTTKK-ASESETTEETYGSSAMETENVAEVVK 1239
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  587 PgEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAeAKSPAEVKSpATVKSPVEAKSPAEVKSPVTVKSPA 666
Cdd:PLN03237 1240 P-KGRAGAKKKAPAAAKEKEEEDEILDLKDRLAAYNLDSAPAQS-AKMEETVKA-VPARRAAARKKPLASVSVISDSDDD 1316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  667 EAKSPVEVKSPASVK-----SPSEAKSPAgAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAK-SPAEAKSPAEAKSPAEA 740
Cdd:PLN03237 1317 DDDFAVEVSLAERLKkkggrKPAAANKKA-AKPPAAAKKRGPATVQSGQKLLTEMLKPAEAIgISPEKKVRKMRASPFNK 1395
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 158341642  741 KSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKsPVKEEIKPPAEVKSPEKAKSP 801
Cdd:PLN03237 1396 KSGSVLGRAATNKETESSENVSGSSSSEKDEIDVSAKPR-PQRANRKQTTYVLSDSESESA 1455
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
509-918 3.40e-09

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 60.77  E-value: 3.40e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  509 ETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAevkspAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEvKSPATVKSPG 588
Cdd:PRK07764  382 ERRLGVAGGAGAPAAAAPSAAAAAPAAAPAPA-----AAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPA-GNAPAGGAPS 455
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  589 EAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSP-GEAKSPAEAKSPAEVKSPATVKSP----VEA------KSPAEVK 657
Cdd:PRK07764  456 PPPAAAPSAQPAPAPAAAPEPTAAPAPAPPAAPAPaAAPAAPAAPAAPAGADDAATLRERwpeiLAAvpkrsrKTWAILL 535
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  658 SPVTV------------KSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSP 725
Cdd:PRK07764  536 PEATVlgvrgdtlvlgfSTGGLARRFASPGNAEVLVTALAEELGGDWQVEAVVGPAPGAAGGEGPPAPASSGPPEEAARP 615
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  726 AEAKSPAEaksPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPmkee 805
Cdd:PRK07764  616 AAPAAPAA---PAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPA---- 688
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  806 aksPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPkk 885
Cdd:PRK07764  689 ---APAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQPPPPPA-- 763
                         410       420       430
                  ....*....|....*....|....*....|...
gi 158341642  886 VEEEKTPATPKTEVKESKKDEAPKEAQKPKAEE 918
Cdd:PRK07764  764 PAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDE 796
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
495-840 7.45e-09

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 59.61  E-value: 7.45e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  495 TTSPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEvKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKS 574
Cdd:PRK07764  399 PSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPA-GNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPT 477
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSP-GEAKSPAEAKSPA-------------EVKSPVEAKSPA--EAKSP-ASV------------KSPGE 625
Cdd:PRK07764  478 AAPAPAPPAAPAPaAAPAAPAAPAAPAgaddaatlrerwpEILAAVPKRSRKtwAILLPeATVlgvrgdtlvlgfSTGGL 557
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  626 AKSPAEAKSPA------------EVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAK 693
Cdd:PRK07764  558 ARRFASPGNAEvlvtalaeelggDWQVEAVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPA 637
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  694 SPAEAKSPVVAKSPAEAKSPAE----------------AKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEK 757
Cdd:PRK07764  638 EASAAPAPGVAAPEHHPKHVAVpdasdggdgwpakaggAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDP 717
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  758 AKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAktldvkSPEAKTPAKEEAKRPADIR 837
Cdd:PRK07764  718 AAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQPPPPPAPAPAAAPAA------APPPSPPSEEEEMAEDDAP 791

                  ...
gi 158341642  838 SPE 840
Cdd:PRK07764  792 SMD 794
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
588-790 7.56e-09

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 59.50  E-value: 7.56e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  588 GEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPAtvkspveAKSPAEVKSPVTVKSPAE 667
Cdd:PRK12323  370 GGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPA-------RRSPAPEALAAARQASAR 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  668 AKSPVEVKSPASVKSPSEAKSPAGAKS---PAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPA 744
Cdd:PRK12323  443 GPGGAPAPAPAPAAAPAAAARPAAAGPrpvAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWV 522
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 158341642  745 EAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPA 790
Cdd:PRK12323  523 AESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRA 568
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
616-809 1.17e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 59.12  E-value: 1.17e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  616 SPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSP 695
Cdd:PRK12323  373 GPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAP 452
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  696 AEAKSPVVAKSPAEAKSPAeakPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSP 775
Cdd:PRK12323  453 APAAAPAAAARPAAAGPRP---VAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDP 529
                         170       180       190
                  ....*....|....*....|....*....|....
gi 158341642  776 EKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSP 809
Cdd:PRK12323  530 ATADPDDAFETLAPAPAAAPAPRAAAATEPVVAP 563
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
665-865 2.40e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 57.96  E-value: 2.40e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  665 PAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAkSPAEAKSPA 744
Cdd:PRK12323  375 ATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGP-GGAPAPAPA 453
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  745 EAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAkt 824
Cdd:PRK12323  454 PAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPAT-- 531
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 158341642  825 pAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAP 865
Cdd:PRK12323  532 -ADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASAS 571
PLN03237 PLN03237
DNA topoisomerase 2; Provisional
594-906 2.40e-08

DNA topoisomerase 2; Provisional


Pssm-ID: 215641  Cd Length: 1465  Bit Score: 58.34  E-value: 2.40e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  594 AEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPvtvkspaEAKSPVE 673
Cdd:PLN03237 1175 AEEAREKLQRAAARGESGAAKKVSRQAPKKPAPKKTTKKASESETTEETYGSSAMETENVAEVVKP-------KGRAGAK 1247
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  674 VKSPASVKSPSEAKSPAGAKSPAEAKSpvVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVK 753
Cdd:PLN03237 1248 KKAPAAAKEKEEEDEILDLKDRLAAYN--LDSAPAQSAKMEETVKAVPARRAAARKKPLASVSVISDSDDDDDDFAVEVS 1325
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  754 SPEKAKspvKEGAKSLAEAKsPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKspekaktlDVKSPEAKTPAKEEAkrp 833
Cdd:PLN03237 1326 LAERLK---KKGGRKPAAAN-KKAAKPPAAAKKRGPATVQSGQKLLTEMLKPAE--------AIGISPEKKVRKMRA--- 1390
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 158341642  834 adirSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEevkAKEPPKKVEEEKTPATPKTEVKESKKDE 906
Cdd:PLN03237 1391 ----SPFNKKSGSVLGRAATNKETESSENVSGSSSSEKDEID---VSAKPRPQRANRKQTTYVLSDSESESAD 1456
PLN03237 PLN03237
DNA topoisomerase 2; Provisional
496-733 2.51e-08

DNA topoisomerase 2; Provisional


Pssm-ID: 215641  Cd Length: 1465  Bit Score: 58.34  E-value: 2.51e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  496 TSPPAEEAASPEKETKS---PVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVA----KSPAEvksPAEVKSPAEAKS 568
Cdd:PLN03237 1217 SETTEETYGSSAMETENvaeVVKPKGRAGAKKKAPAAAKEKEEEDEILDLKDRLAAynldSAPAQ---SAKMEETVKAVP 1293
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  569 PAEAKSPAEVKSPATVKSPGEAKSPAEAkspAEVKSPVEAKSPAEAKSPASVKSPgeAKSPAEAKSPAEVKSPATVKSPV 648
Cdd:PLN03237 1294 ARRAAARKKPLASVSVISDSDDDDDDFA---VEVSLAERLKKKGGRKPAAANKKA--AKPPAAAKKRGPATVQSGQKLLT 1368
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  649 EAKSPAEVKSPVTVKSPAEA-KSPVEVKSPASVKSPSEAKSPAG----AKSPAEAKSPVVAKSPAEAKSpAEAKPPAEAK 723
Cdd:PLN03237 1369 EMLKPAEAIGISPEKKVRKMrASPFNKKSGSVLGRAATNKETESsenvSGSSSSEKDEIDVSAKPRPQR-ANRKQTTYVL 1447
                         250
                  ....*....|
gi 158341642  724 SPAEAKSPAE 733
Cdd:PLN03237 1448 SDSESESADD 1457
infB PRK05306
translation initiation factor IF-2; Validated
672-836 2.89e-08

translation initiation factor IF-2; Validated


Pssm-ID: 235401  Cd Length: 746  Bit Score: 57.55  E-value: 2.89e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  672 VEVKSPASVKSPSEA-KSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPV 750
Cdd:PRK05306   29 IEVKSHSSTVEEEEArKEEAKREAEEEAKAEAEEAAAAEAEEEAKAEAAAAAPAEEAAEAAAAAEAAARPAEDEAARPAE 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  751 EVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKS-PEKAKTLDVKSPEAKTP---A 826
Cdd:PRK05306  109 AAARRPKAKKAAKKKKGPKPKKKKPKRKAARGGKRGKGGKGRRRRRGRRRRRKKKKKQkPTEKIPREVVIPETITVaelA 188
                         170
                  ....*....|
gi 158341642  827 KEEAKRPADI 836
Cdd:PRK05306  189 EKMAVKAAEV 198
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
594-727 3.05e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 57.42  E-value: 3.05e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  594 AEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPaevkspvtvksPAEAKSPVE 673
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAP-----------AAAAPAAAP 438
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 158341642  674 VKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAE 727
Cdd:PRK14951  439 AAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
522-643 3.07e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 57.42  E-value: 3.07e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  522 AEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAE 601
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 158341642  602 VKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPAT 643
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPT 491
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
590-775 3.12e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 57.55  E-value: 3.12e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  590 AKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAeakSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAK 669
Cdd:PRK07003  364 GGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTG---AAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGD 440
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  670 SPVevKSPASVKSPSEAKSPAGAKSPAEAKSPvvAKSPAEAKSPAEAKPPA---EAKSPAEAKSPAEAKSPAEAKSPAEA 746
Cdd:PRK07003  441 DAA--DGDAPVPAKANARASADSRCDERDAQP--PADSGSASAPASDAPPDaafEPAPRAAAPSAATPAAVPDARAPAAA 516
                         170       180
                  ....*....|....*....|....*....
gi 158341642  747 KSPVEvksPEKAKSPVKEGAKSLAEAKSP 775
Cdd:PRK07003  517 SREDA---PAAAAPPAPEARPPTPAAAAP 542
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
498-623 6.09e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 56.65  E-value: 6.09e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  498 PPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAkSPAEVKSPAEVKSPAEAKSPAEAKSPAE 577
Cdd:PRK14951  366 PAAAAEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAA-PPAAAPPAPVAAPAAAAPAAAPAAAPAA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 158341642  578 VKSPAtvkSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSP 623
Cdd:PRK14951  445 VALAP---APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAAR 487
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
624-751 8.88e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 55.88  E-value: 8.88e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  624 GEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPvtvksPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVV 703
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAA-----APAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 158341642  704 AKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVE 751
Cdd:PRK14951  445 VALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
528-649 9.43e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 55.88  E-value: 9.43e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  528 AEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPG-EAKSPAEAKSPAEVKSPV 606
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAaAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 158341642  607 EAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVE 649
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PTZ00144 PTZ00144
dihydrolipoamide succinyltransferase; Provisional
602-748 1.02e-07

dihydrolipoamide succinyltransferase; Provisional


Pssm-ID: 240289  Cd Length: 418  Bit Score: 55.46  E-value: 1.02e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  602 VKSPVEAKSPAEAKSPASVKSPGEAKSPAEAkspaeVKSPATVKSPVEAKSPAevkSPVTVKSPAEAKSPVEVKSPASVK 681
Cdd:PTZ00144   47 IKVPTMGDSISEGTVVEWKKKVGDYVKEDEV-----ICIIETDKVSVDIRAPA---SGVITKIFAEEGDTVEVGAPLSEI 118
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 158341642  682 SPSEAKSPAGAKSPAEAKSPvvAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKS 748
Cdd:PTZ00144  119 DTGGAPPAAAPAAAAAAKAE--KTTPEKPKAAAPTPEPPAASKPTPPAAAKPPEPAPAAKPPPTPVA 183
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
99-410 1.25e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 55.88  E-value: 1.25e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   99 EQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQagraamgelyerevREMRGAVLRLGAARGQLRLEQEHLLEDI 178
Cdd:COG1196   674 EELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQL--------------EELERQLEELKRELAALEEELEQLQSRL 739
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  179 AHVRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEEcgylRRHHQEEVGELLGQIQgcgaaqaqaqae 258
Cdd:COG1196   740 EELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEK----RQALQEELEELEEELE------------ 803
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  259 ardalkcdvtsalreiRAQLEGHTVQSTLQSEEwfrVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKST 338
Cdd:COG1196   804 ----------------EAERRLDALERELESLE---QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEE 864
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158341642  339 KESLERQRSELED---RHQVDMASYQDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEE 410
Cdd:COG1196   865 LEELEAEKEELEDelkELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEY 939
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
540-756 1.39e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 55.38  E-value: 1.39e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  540 AEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPAS 619
Cdd:PRK07764  586 AVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDG 665
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  620 VKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAK 699
Cdd:PRK07764  666 GDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEP 745
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 158341642  700 SPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPE 756
Cdd:PRK07764  746 DDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAE 802
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
660-839 2.12e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 54.86  E-value: 2.12e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  660 VTVKSPAEAKSPVEVksPASVKSPSEAKSPAGAKSPAEAKSPVVAKsPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAE 739
Cdd:PRK07003  362 VTGGGAPGGGVPARV--AGAVPAPGARAAAAVGASAVPAVTAVTGA-AGAALAPKAAAAAAATRAEAPPAAPAPPATADR 438
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  740 AKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSP-------VKEEIKPPAEVKSPekAKSPMKEEAKSPEKA 812
Cdd:PRK07003  439 GDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPasdappdAAFEPAPRAAAPSA--ATPAAVPDARAPAAA 516
                         170       180
                  ....*....|....*....|....*..
gi 158341642  813 KTLDVKSPEAKTPAKEEAKRPADIRSP 839
Cdd:PRK07003  517 SREDAPAAAAPPAPEARPPTPAAAAPA 543
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
624-812 2.20e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 54.88  E-value: 2.20e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  624 GEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASvKSPSEAKSPAGAKSPAEAKSPVV 703
Cdd:PRK12323  370 GGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPAR-RSPAPEALAAARQASARGPGGAP 448
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  704 AKSPAEAKSPAEA-KPPAE--AKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKS 780
Cdd:PRK12323  449 APAPAPAAAPAAAaRPAAAgpRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPD 528
                         170       180       190
                  ....*....|....*....|....*....|..
gi 158341642  781 PVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKA 812
Cdd:PRK12323  529 PATADPDDAFETLAPAPAAAPAPRAAAATEPV 560
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
548-899 2.28e-07

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904  Cd Length: 886  Bit Score: 54.92  E-value: 2.28e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   548 AKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGeakSPAEAKSPAEVKSPVEAKSPAEAkSPASvKSPGEAK 627
Cdd:pfam05109  422 SKAPESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPA---STGPTVSTADVTSPTPAGTTSGA-SPVT-PSPSPRD 496
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   628 SPAEAKSPAEVKSPATVKSPV-EAKSPAEVkspVTVKSPAEAKSPVEVKSPAS-VKSPS---EAKSPAGAKSPAEAKSPV 702
Cdd:pfam05109  497 NGTESKAPDMTSPTSAVTTPTpNATSPTPA---VTTPTPNATSPTLGKTSPTSaVTTPTpnaTSPTPAVTTPTPNATIPT 573
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   703 VAKSpaeAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSpAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSP- 781
Cdd:pfam05109  574 LGKT---SPTSAVTTPTPNATSPTVGETSPQANTTNHTLG-GTSSTPVVTSPPKNATSAVTTGQHNITSSSTSSMSLRPs 649
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   782 -VKEEIKPPAEVKSpeKAKSPMKEEAKsPEKAKTLDVKSPEAKTPAKEEAKRPADirspeqvKSPAKEEAKSPEKEETRT 860
Cdd:pfam05109  650 sISETLSPSTSDNS--TSHMPLLTSAH-PTGGENITQVTPASTSTHHVSTSSPAP-------RPGTTSQASGPGNSSTST 719
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 158341642   861 ekvapKKEEVKspveeVKAKEPPKKVEEEKTPATPKTEV 899
Cdd:pfam05109  720 -----KPGEVN-----VTKGTPPKNATSPQAPSGQKTAV 748
PRK07735 PRK07735
NADH dehydrogenase subunit C; Validated
497-767 2.39e-07

NADH dehydrogenase subunit C; Validated


Pssm-ID: 236081  Cd Length: 430  Bit Score: 54.22  E-value: 2.39e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  497 SPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEakspaEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPA 576
Cdd:PRK07735    1 MDPEKDLEDLKKEAARRAKEEARKRLVAKHGAE-----ISKLEEENREKEKALPKNDDMTIEEAKRRAAAAAKAKAAALA 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  577 EVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEV 656
Cdd:PRK07735   76 KQKREGTEEVTEEEKAKAKAKAAAAAKAKAAALAKQKREGTEEVTEEEKAAAKAKAAAAAKAKAAALAKQKREGTEEVTE 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  657 KSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKS 736
Cdd:PRK07735  156 EEEETDKEKAKAKAAAAAKAKAAALAKQKAAEAGEGTEEVTEEEKAKAKAKAAAAAKAKAAALAKQKASQGNGDSGDEDA 235
                         250       260       270
                  ....*....|....*....|....*....|.
gi 158341642  737 PAEAKSPAEAKSPVEVKSPEKAKSPVKEGAK 767
Cdd:PRK07735  236 KAKAIAAAKAKAAAAARAKTKGAEGKKEEEP 266
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
606-790 2.75e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 54.47  E-value: 2.75e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  606 VEAKSPAEAKSPASVksPGEAKSPAEAKSPAEVKSPATVKSPVEAKsPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSE 685
Cdd:PRK07003  362 VTGGGAPGGGVPARV--AGAVPAPGARAAAAVGASAVPAVTAVTGA-AGAALAPKAAAAAAATRAEAPPAAPAPPATADR 438
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  686 AKSPAGAKSPAEAKSPVvaksPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEG 765
Cdd:PRK07003  439 GDDAADGDAPVPAKANA----RASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPA 514
                         170       180
                  ....*....|....*....|....*
gi 158341642  766 AKSLAEAKSPEKAKSPVKEEIKPPA 790
Cdd:PRK07003  515 AASREDAPAAAAPPAPEARPPTPAA 539
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
503-631 2.77e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 54.34  E-value: 2.77e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  503 AASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPA 582
Cdd:PRK14951  363 AFKPAAAAEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAP 442
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 158341642  583 TVKSPGEAKSPAEAKSPAEVKSPVEA-KSPAEAKSPASVKSPGEAKSPAE 631
Cdd:PRK14951  443 AAVALAPAPPAQAAPETVAIPVRVAPePAVASAAPAPAAAPAAARLTPTE 492
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
596-764 2.91e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138  Cd Length: 647  Bit Score: 54.49  E-value: 2.91e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  596 AKSPAEVkSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPatvksPVEAKSPAEVKSPVTVKSPAEAKSPVEVK 675
Cdd:PRK07994  358 AFHPAAP-LPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPP-----PASAPQQAPAVPLPETTSQLLAARQQLQR 431
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  676 SPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAkSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSP 755
Cdd:PRK07994  432 AQGATKAKKSEPAAASRARPVNSALERLASVRPAPSALEKAPAKKEA-YRWKATNPVEVKKEPVATPKALKKALEHEKTP 510

                  ....*....
gi 158341642  756 EKAKSPVKE 764
Cdd:PRK07994  511 ELAAKLAAE 519
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
496-806 3.15e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 54.22  E-value: 3.15e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  496 TSPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEvKSPAEVKSPAEAKSPAEAKSP 575
Cdd:PRK07764  425 PAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPTAAPAP-APPAAPAPAAAPAAPAAPAAP 503
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  576 ----------------------------AEVKSPATV------------KSPGEAKSPAEAKSP---------------- 599
Cdd:PRK07764  504 agaddaatlrerwpeilaavpkrsrktwAILLPEATVlgvrgdtlvlgfSTGGLARRFASPGNAevlvtalaeelggdwq 583
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  600 --AEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSP 677
Cdd:PRK07764  584 veAVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDAS 663
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  678 ASVK-SPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPE 756
Cdd:PRK07764  664 DGGDgWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPP 743
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 158341642  757 KAKSPVKEGAKSLAEAK----SPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEA 806
Cdd:PRK07764  744 EPDDPPDPAGAPAQPPPppapAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDED 797
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
558-679 3.94e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 53.95  E-value: 3.94e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  558 AEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAE 637
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 158341642  638 VKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPAS 679
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPT 491
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
640-835 3.97e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 54.11  E-value: 3.97e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  640 SPATVKS-PVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAgAKSPAEAKSPVVAKSPAEAKSPAEAKP 718
Cdd:PRK12323  373 GPATAAAaPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPA-RRSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  719 PAeaksPAEAKSPAEAKSPAEAKS-PAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVK--SP 795
Cdd:PRK12323  452 PA----PAAAPAAAARPAAAGPRPvAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAesIP 527
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 158341642  796 EKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPAD 835
Cdd:PRK12323  528 DPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPR 567
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
114-399 3.98e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 54.34  E-value: 3.98e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  114 KVRQLEAHNRSLEGEAAALRQQQAGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDEEARQRE 193
Cdd:COG1196   240 ELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELE 319
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  194 EAEAAARALARFAQEAEAARVELQKKAQALQEEcgylrrhhQEEVGELLGQIQgcgaAQAQAQAEARDALKCDVTSALRE 273
Cdd:COG1196   320 ELEERLEELKEKIEALKEELEERETLLEELEQL--------LAELEEAKEELE----EKLSALLEELEELFEALREELAE 387
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  274 IRAQL-----EGHTVQSTLQSEEwfrVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKESLERQRSE 348
Cdd:COG1196   388 LEAELaeirnELEELKREIESLE---ERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKE 464
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 158341642  349 LEDRHQvdmaSYQDAIQQLDNEL---RNTKWEMAAQLREYQDLLNVKMALDIEI 399
Cdd:COG1196   465 LERELA----ELQEELQRLEKELsslEARLDRLEAEQRASQGVRAVLEALESGL 514
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
528-752 4.18e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 53.84  E-value: 4.18e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  528 AEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEvkspve 607
Cdd:PRK07764  586 AVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAV------ 659
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  608 aKSPAEAKSPASVKSPGEA-KSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEA 686
Cdd:PRK07764  660 -PDASDGGDGWPAKAGGAApAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDP 738
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 158341642  687 KSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEV 752
Cdd:PRK07764  739 VPLPPEPDDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAEEV 804
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
688-895 4.79e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 53.73  E-value: 4.79e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  688 SPAGAKSPAEAKSPVVAKSPAEAkSPAEAKPPAEAKSPAEAKSPAEAKSPAEAK-SPAEAKSPVEVKSPEKAKSPVKEGA 766
Cdd:PRK12323  373 GPATAAAAPVAQPAPAAAAPAAA-APAPAAPPAAPAAAPAAAAAARAVAAAPARrSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  767 KSLAEAKSPeKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPA 846
Cdd:PRK12323  452 PAPAAAPAA-AARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPA 530
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 158341642  847 KEEAkSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATP 895
Cdd:PRK12323  531 TADP-DDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFD 578
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
675-771 5.03e-07

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030  Cd Length: 1228  Bit Score: 53.74  E-value: 5.03e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  675 KSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKs 754
Cdd:PRK12270   40 STAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEVT- 118
                          90
                  ....*....|....*..
gi 158341642  755 pekaksPVKEGAKSLAE 771
Cdd:PRK12270  119 ------PLRGAAAAVAK 129
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
522-746 5.77e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 53.45  E-value: 5.77e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  522 AEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAE 601
Cdd:PRK07764  586 AVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDG 665
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  602 VKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVK 681
Cdd:PRK07764  666 GDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEP 745
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158341642  682 SPSEAKSPAGAKSPAEaksPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEA 746
Cdd:PRK07764  746 DDPPDPAGAPAQPPPP---PAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAEEVAME 807
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
546-766 7.08e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 53.07  E-value: 7.08e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  546 AVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPAtvkSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGE 625
Cdd:PRK07764  586 AVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPA---APAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDA 662
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  626 AKSPAEAKSPAEVKSPATVKSPVEAKSPAEvKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAK 705
Cdd:PRK07764  663 SDGGDGWPAKAGGAAPAAPPPAPAPAAPAA-PAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPL 741
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 158341642  706 SPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGA 766
Cdd:PRK07764  742 PPEPDDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAE 802
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
612-732 7.35e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 53.18  E-value: 7.35e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  612 AEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAG 691
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 158341642  692 AKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPA 732
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTP 490
Retinal pfam15449
Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. ...
498-732 7.70e-07

Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. Mutations of the gene encoding this protein have been associated with retinal disorders such as retinitis pigmentosa and late-onset progressive retinal atrophy. The function of this family of proteins is unknown, but it is likely to be important in the development and function of the retina.


Pssm-ID: 317802  Cd Length: 1292  Bit Score: 53.26  E-value: 7.70e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   498 PPAEEAASPEKETKSPV----------KEEAKSPAEAKSPAEAKSPaEAKSPAEVKSPAVAK--SPAEVK--SPAEVKSP 563
Cdd:pfam15449  956 AQAEEAASLSKQPQKAIpwhhsshtsgQSRTSEPSLARPTRGPHSP-EAPRQSQERSPPLVRkaSPTRAHwaPRADRRHP 1034
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   564 aeakSPAEAKSPAEVKSPATVKSPGEAKSPAeaksPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAK-SPAEVKSPA 642
Cdd:pfam15449 1035 ----SLPSSHRPAQPSLPTVQRSPSPPLSPA----PSPPASPRVLSPPTSKKRTSPPPQHKLPSPPPESPqAQHKLSSPP 1106
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   643 TVKSpvEAKSPAEVKSPVTVKSPA----EAKSPvEVKSPASVKSPSEAKS---PAgAKSPAEAKSPVvakspaeakSPAE 715
Cdd:pfam15449 1107 TQRT--EASSPSSGPSPSPPTSPSqgpkETRDS-EDSQAATAKASGNTCSifcPA-TSSLFEAKSPF---------STAH 1173
                          250
                   ....*....|....*..
gi 158341642   716 AKPPAEAKSPAEAKSPA 732
Cdd:pfam15449 1174 PLPPPEAGGPLGTPAGG 1190
PHA03247 PHA03247
large tegument protein UL36; Provisional
647-1043 8.69e-07

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 53.40  E-value: 8.69e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  647 PVEAKSPAEVKSpvtVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPA 726
Cdd:PHA03247 2556 PPAAPPAAPDRS---VPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPS 2632
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  727 EAKSPAEAKSPAEA---KSPAEAKSPVEVKSPEKAKSPVK-EGAKSLAEAKSPEKAK---SPVKEEIKPPAEVKSPEKAK 799
Cdd:PHA03247 2633 PAANEPDPHPPPTVpppERPRDDPAPGRVSRPRRARRLGRaAQASSPPQRPRRRAARptvGSLTSLADPPPPPPTPEPAP 2712
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  800 SPMKEEAKSPEKAKTLDVKSPE-----AKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPV 874
Cdd:PHA03247 2713 HALVSATPLPPGPAAARQASPAlpaapAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLS 2792
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  875 EEVKAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQKPKAEEKEPltEKPKDSPGEAKKEEAKEKKAAAPEEETPAKL 954
Cdd:PHA03247 2793 ESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAP--PPPPGPPPPSLPLGGSVAPGGDVRRRPPSRS 2870
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  955 GVkeeAKPKEKAEDAKAKEPSKPSEKEKPKKEEVPAAPEKKDTKEEKTTESKKPEEKPKMEAKAKEEDKGLPQEPSKPKT 1034
Cdd:PHA03247 2871 PA---AKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTT 2947

                  ....*....
gi 158341642 1035 EKAEKSSST 1043
Cdd:PHA03247 2948 DPAGAGEPS 2956
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
648-765 1.00e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 52.41  E-value: 1.00e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  648 VEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKS-------PAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPA 720
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAasapaapPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 158341642  721 EAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEG 765
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTEEG 494
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
649-845 1.18e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 52.57  E-value: 1.18e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  649 EAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKS-PAE 727
Cdd:PRK12323  371 GAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGaPAP 450
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  728 AKSPAEAKSPAEAKSPAEAKSPVevkspekAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEK--AKSPMKEE 805
Cdd:PRK12323  451 APAPAAAPAAAARPAAAGPRPVA-------AAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQpdAAPAGWVA 523
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 158341642  806 AKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSP 845
Cdd:PRK12323  524 ESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAP 563
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
666-791 1.21e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 52.41  E-value: 1.21e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  666 AEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAE 745
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 158341642  746 AKSPVEvkSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAE 791
Cdd:PRK14951  450 APPAQA--APETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTEE 493
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
665-785 1.27e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 52.41  E-value: 1.27e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  665 PAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPA 744
Cdd:PRK14951  375 PAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAPAPPAQ 454
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 158341642  745 EAKSPVEVKSPEKAKSPVKEGAKslAEAKSPEKAKSPVKEE 785
Cdd:PRK14951  455 AAPETVAIPVRVAPEPAVASAAP--APAAAPAAARLTPTEE 493
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
606-733 1.73e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 51.64  E-value: 1.73e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  606 VEAKSPAEAKSPAsvksPGEAKSPAeAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSE 685
Cdd:PRK14951  370 AEAAAPAEKKTPA----RPEAAAPA-AAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 158341642  686 AKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAE 733
Cdd:PRK14951  445 VALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
618-738 1.90e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 51.64  E-value: 1.90e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  618 ASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAE 697
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 158341642  698 AKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPA 738
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTP 490
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
522-790 1.99e-06

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748  Cd Length: 576  Bit Score: 51.47  E-value: 1.99e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  522 AEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKspATVKSPGEAKSPAEAKSPAE 601
Cdd:PLN03209  307 AETTAPLTPMEELLAKIPSQRVPPKESDAADGPKPVPTKPVTPEAPSPPIEEEPPQPK--AVVPRPLSPYTAYEDLKPPT 384
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  602 VKSPVEAKS-PAEAKSPASVKSPGEAKSPAEAKSPAEVksPATVKSPVEAKSpAEVKSPVTVKS---PAEAKSPvevkSP 677
Cdd:PLN03209  385 SPIPTPPSSsPASSKSVDAVAKPAEPDVVPSPGSASNV--PEVEPAQVEAKK-TRPLSPYARYEdlkPPTSPSP----TA 457
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  678 ASVKSPSEAKSPAGAKSPAEAksPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEK 757
Cdd:PLN03209  458 PTGVSPSVSSTSSVPAVPDTA--PATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPAAPVGKVAPSSTNEVVKVGNS 535
                         250       260       270
                  ....*....|....*....|....*....|...
gi 158341642  758 AKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPA 790
Cdd:PLN03209  536 APPTALADEQHHAQPKPRPLSPYTMYEDLKPPT 568
Glutenin_hmw pfam03157
High molecular weight glutenin subunit; Members of this family include high molecular weight ...
505-781 2.11e-06

High molecular weight glutenin subunit; Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.


Pssm-ID: 281191  Cd Length: 772  Bit Score: 51.68  E-value: 2.11e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   505 SPEKETKSPVKEEAKSPAEAKSPAEAKS---------PAEAKSPAEVKSPAVAKS---PAEVKSPAEVKSPAEAKSPA-- 570
Cdd:pfam03157   51 SPQQVSYYPGQASPQRPGQGQQPGQGQQsgqgqqgyyPTSPQQPGQWQQPEQGQPgyyPTSPQQPGQLQQPAQGQQPGqg 130
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   571 -EAKSPAEVK----SPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPA---SVKSPGEAKSPAEAKSPAEVKSPA 642
Cdd:pfam03157  131 qQGRQPGQGQpgyyPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGqgqQGQQPGQGQQPGQGQQGQQLGQGQ 210
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   643 TVKSPVEAKSPAEVKS---PVTVKSPAEAKS---PVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEA 716
Cdd:pfam03157  211 QGYYPTSLQQSGQGQPgyyPTSLQQLGQGQSgyyPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQGQQGQQPGQG 290
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 158341642   717 KPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSlaEAKSPEKAKSP 781
Cdd:pfam03157  291 QQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQ--QAQQPGQGQQP 353
Retinal pfam15449
Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. ...
506-811 2.52e-06

Retinal protein; This family of proteins is found in the photoreceptor cells of the retina. Mutations of the gene encoding this protein have been associated with retinal disorders such as retinitis pigmentosa and late-onset progressive retinal atrophy. The function of this family of proteins is unknown, but it is likely to be important in the development and function of the retina.


Pssm-ID: 317802  Cd Length: 1292  Bit Score: 51.72  E-value: 2.52e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   506 PEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAevksPAVAKSPaEVKSPAEVKSPAEaKSPAEAKSPAEV---KSPA 582
Cdd:pfam15449  905 PSKSTASPTRPRSTGPGSSKSGCNPRKLALDLNHP----PAASHNP-EAEGGAQSQAQAE-EAASLSKQPQKAipwHHSS 978
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   583 TVKSPGEAKSPAEAKSPAEVKSPvEAKSPAEAKSPASVKSpgeaKSPAEAK--SPAEVKSPatvkSPVEAKSPAEVKSPV 660
Cdd:pfam15449  979 HTSGQSRTSEPSLARPTRGPHSP-EAPRQSQERSPPLVRK----ASPTRAHwaPRADRRHP----SLPSSHRPAQPSLPT 1049
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   661 TVKSPAEAKSPVEvKSPASVKSPSEAKSPAGAKSPAEAKSPvvakspaeakSPAEAKPPAEAKSPAEAKSPAEAKSPAEA 740
Cdd:pfam15449 1050 VQRSPSPPLSPAP-SPPASPRVLSPPTSKKRTSPPPQHKLP----------SPPPESPQAQHKLSSPPTQRTEASSPSSG 1118
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   741 KSPAEAKSPV----EVKSPEKAK-SPVKEG----------AKSLAEAKSPEKAKSPvkeeiKPPAEVKSPEKAKSPMKEE 805
Cdd:pfam15449 1119 PSPSPPTSPSqgpkETRDSEDSQaATAKASgntcsifcpaTSSLFEAKSPFSTAHP-----LPPPEAGGPLGTPAGGWRS 1193

                   ....*.
gi 158341642   806 AKSPEK 811
Cdd:pfam15449 1194 SSGPRL 1199
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
570-691 2.79e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 51.25  E-value: 2.79e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  570 AEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVE 649
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 158341642  650 AKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAG 691
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPT 491
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
564-686 3.40e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 50.87  E-value: 3.40e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  564 AEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPAT 643
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 158341642  644 VKSPVEAKSPAEVksPVTVKSPAEAKSPVEVKSPASVKSPSEA 686
Cdd:PRK14951  450 APPAQAAPETVAI--PVRVAPEPAVASAAPAPAAAPAAARLTP 490
infB PRK05306
translation initiation factor IF-2; Validated
750-901 3.69e-06

translation initiation factor IF-2; Validated


Pssm-ID: 235401  Cd Length: 746  Bit Score: 51.00  E-value: 3.69e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  750 VEVKSPekaKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKtldVKSPEAKTPAKEE 829
Cdd:PRK05306   29 IEVKSH---SSTVEEEEARKEEAKREAEEEAKAEAEEAAAAEAEEEAKAEAAAAAPAEEAAEAA---AAAEAAARPAEDE 102
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158341642  830 AKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATPKTEVKE 901
Cdd:PRK05306  103 AARPAEAAARRPKAKKAAKKKKGPKPKKKKPKRKAARGGKRGKGGKGRRRRRGRRRRRKKKKKQKPTEKIPR 174
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
675-890 3.96e-06

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271  Cd Length: 1388  Bit Score: 50.82  E-value: 3.96e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  675 KSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKS 754
Cdd:PTZ00108 1158 LKSKTKGKASKLRKPKLKKKEKKKKKSSADKSKKASVVGNSKRVDSDEKRKLDDKPDNKKSNSSGSDQEDDEEQKTKPKK 1237
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  755 PEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKS----------PEKAKSPMKEEAKSPEKAKTLDVKSPEAKT 824
Cdd:PTZ00108 1238 SSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGKPKNAPKRvsavqyspppPSKRPDGESNGGSKPSSPTKKKVKKRLEGS 1317
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 158341642  825 PAKEEAKRPADIRSPEQVKSPaKEEAKSPEKEETRTEKvAPKKEEVKSPVEEVKAKEPPKKVEEEK 890
Cdd:PTZ00108 1318 LAALKKKKKSEKKTARKKKSK-TRVKQASASQSSRLLR-RPRKKKSDSSSEDDDDSEVDDSEDEDD 1381
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
552-671 4.87e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 50.48  E-value: 4.87e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  552 AEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAE 631
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 158341642  632 AKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSP 671
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLT 489
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
534-661 5.68e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 50.10  E-value: 5.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  534 AEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSpaevkSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAE 613
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAA-----ASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 158341642  614 AkSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVT 661
Cdd:PRK14951  445 V-ALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPT 491
PRK07735 PRK07735
NADH dehydrogenase subunit C; Validated
631-873 6.95e-06

NADH dehydrogenase subunit C; Validated


Pssm-ID: 236081  Cd Length: 430  Bit Score: 49.59  E-value: 6.95e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  631 EAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEA 710
Cdd:PRK07735   34 ISKLEEENREKEKALPKNDDMTIEEAKRRAAAAAKAKAAALAKQKREGTEEVTEEEKAKAKAKAAAAAKAKAAALAKQKR 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  711 KSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPA 790
Cdd:PRK07735  114 EGTEEVTEEEKAAAKAKAAAAAKAKAAALAKQKREGTEEVTEEEEETDKEKAKAKAAAAAKAKAAALAKQKAAEAGEGTE 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  791 EVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEV 870
Cdd:PRK07735  194 EVTEEEKAKAKAKAAAAAKAKAAALAKQKASQGNGDSGDEDAKAKAIAAAKAKAAAAARAKTKGAEGKKEEEPKQEEPSV 273

                  ...
gi 158341642  871 KSP 873
Cdd:PRK07735  274 NQP 276
rne PRK10811
ribonuclease E; Reviewed
507-836 7.52e-06

ribonuclease E; Reviewed


Pssm-ID: 236766  Cd Length: 1068  Bit Score: 50.04  E-value: 7.52e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  507 EKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKspaevKSPATVKS 586
Cdd:PRK10811  732 EQSVAEEAVAPVVEETVAAEPVVQEVPAPRTELVKVPLPVVAQTAPEQDEENNAENRDNNGMPRRSR-----RSPRHLRV 806
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  587 PGE-------AKSPAEAKSPAEVK--SPVEAKSPAEAKSPasVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVK 657
Cdd:PRK10811  807 SGQrrrryrdERYPTQSPMPLTVAcaSPEMASGKVWIRYP--VVRPQDVQVEEQREAEEVQVQPVVAEVPVAAAVEPVVS 884
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  658 SPVTVKSPAEAKSPVEVKSPASVKS-PSEAKSPAGAKSPAEAKSPVVAKS--PAEAKSPAEAKPPAEAKSPAEAKSPAEA 734
Cdd:PRK10811  885 APVVEAVAEVVEEPVVVAEPQPEEVvVVETTHPEVIAAPVTEQPQVITESdvAVAQEVAEHAEPVVEPQDETADIEEAAE 964
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  735 KSPAEAKSPAEAKSPVEVKSPEKAKSPVKEgakslaeakspeKAKSPVKEEIKPPAEVKSPEKAKSPMkeeakspekakt 814
Cdd:PRK10811  965 TAEVVVAEPEVVAQPAAPVVAEVAAEVETV------------TAVEPEVAPAQVPEATVEHNHATAPM------------ 1020
                         330       340
                  ....*....|....*....|..
gi 158341642  815 ldvkspeAKTPAKEEAKRPADI 836
Cdd:PRK10811 1021 -------TRAPAPEYVPEAPRH 1035
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
690-801 7.59e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 49.71  E-value: 7.59e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  690 AGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVK---SPEKAKSPVKEGA 766
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAApaaAPAAAPAAVALAP 449
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 158341642  767 KSLAEAkSPEKAKSPVKEEIKPPAEVKSPEKAKSP 801
Cdd:PRK14951  450 APPAQA-APETVAIPVRVAPEPAVASAAPAPAAAP 483
PLN03237 PLN03237
DNA topoisomerase 2; Provisional
476-760 8.67e-06

DNA topoisomerase 2; Provisional


Pssm-ID: 215641  Cd Length: 1465  Bit Score: 49.86  E-value: 8.67e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  476 KEAQGEEE-EEAEEGGEEAATTSPPAEEAASPEKETKSPVKEEAkSPAEAKSPAEAKSPAEAKSPAEVKSPavakspaEV 554
Cdd:PLN03237 1171 EDAKAEEArEKLQRAAARGESGAAKKVSRQAPKKPAPKKTTKKA-SESETTEETYGSSAMETENVAEVVKP-------KG 1242
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  555 KSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAeAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKS 634
Cdd:PLN03237 1243 RAGAKKKAPAAAKEKEEEDEILDLKDRLAAYNLDSAPAQS-AKMEETVKAVPARRAAARKKPLASVSVISDSDDDDDDFA 1321
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  635 PAEVKSPATVK---------SPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGA-KSPAEAKSPVVA 704
Cdd:PLN03237 1322 VEVSLAERLKKkggrkpaaaNKKAAKPPAAAKKRGPATVQSGQKLLTEMLKPAEAIGISPEKKVRKMrASPFNKKSGSVL 1401
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 158341642  705 KSPAEAKSPAEAKPpaEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKS 760
Cdd:PLN03237 1402 GRAATNKETESSEN--VSGSSSSEKDEIDVSAKPRPQRANRKQTTYVLSDSESESA 1455
infB PRK05306
translation initiation factor IF-2; Validated
721-867 9.41e-06

translation initiation factor IF-2; Validated


Pssm-ID: 235401  Cd Length: 746  Bit Score: 49.46  E-value: 9.41e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  721 EAKSPAEAKSPAEAKSPaEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKS 800
Cdd:PRK05306   30 EVKSHSSTVEEEEARKE-EAKREAEEEAKAEAEEAAAAEAEEEAKAEAAAAAPAEEAAEAAAAAEAAARPAEDEAARPAE 108
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 158341642  801 PMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKK 867
Cdd:PRK05306  109 AAARRPKAKKAAKKKKGPKPKKKKPKRKAARGGKRGKGGKGRRRRRGRRRRRKKKKKQKPTEKIPRE 175
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
708-826 1.02e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 49.33  E-value: 1.02e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  708 AEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIK 787
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 158341642  788 PPAEVKSPEKAKSPMKEEaksPEKAKTLDVKSPEAKTPA 826
Cdd:PRK14951  450 APPAQAAPETVAIPVRVA---PEPAVASAAPAPAAAPAA 485
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
691-920 1.05e-05

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273344  Cd Length: 1096  Bit Score: 49.61  E-value: 1.05e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   691 GAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKS----PAEAKSPAEAKSPAEAKSP-----VEVKSPEKAKSP 761
Cdd:TIGR00927  642 GERTGEEGERPTEAEGENGEESGGEAEQEGETETKGENESegeiPAERKGEQEGEGEIEAKEAdhkgeTEAEEVEHEGET 721
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   762 VKEGAKSLAEAKSPEKAKSpVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQ 841
Cdd:TIGR00927  722 EAEGTEDEGEIETGEEGEE-VEDEGEGEAEGKHEVETEGDRKETEHEGETEAEGKEDEDEGEIQAGEDGEMKGDEGAEGK 800
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   842 VKSPAKEEAKSPEKEETRTEKVAPkKEEVKSPVEEV--------KAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQK 913
Cdd:TIGR00927  801 VEHEGETEAGEKDEHEGQSETQAD-DTEVKDETGEQelnaenqgEAKQDEKGVDGGGGSDGGDSEEEEEEEEEEEEEEEE 879

                   ....*..
gi 158341642   914 PKAEEKE 920
Cdd:TIGR00927  880 EEEEEEE 886
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
704-825 1.06e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 49.33  E-value: 1.06e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  704 AKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSlAEAKSPEKAKSPVK 783
Cdd:PRK14951  372 AAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAA-APAAAPAAVALAPA 450
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 158341642  784 EEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTP 825
Cdd:PRK14951  451 PPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
650-801 1.15e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138  Cd Length: 647  Bit Score: 49.09  E-value: 1.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  650 AKSPAEVKSPVTVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAK 729
Cdd:PRK07994  362 AAPLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAKKS 441
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158341642  730 SPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVkeeIKPPAEVKSPEKAKSP 801
Cdd:PRK07994  442 EPAAASRARPVNSALERLASVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPV---ATPKALKKALEHEKTP 510
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
496-716 1.25e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090  Cd Length: 824  Bit Score: 49.21  E-value: 1.25e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  496 TSPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAK-S 574
Cdd:PRK07764  590 PAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDgW 669
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  575 PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPa 654
Cdd:PRK07764  670 PAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDP- 748
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158341642  655 EVKSPVTVKSPAEAkSPVEVKSPASVKSPSEAksPAGAKSPAEAKSPVVAKSPAEAKSPAEA 716
Cdd:PRK07764  749 PDPAGAPAQPPPPP-APAPAAAPAAAPPPSPP--SEEEEMAEDDAPSMDDEDRRDAEEVAME 807
infB PRK05306
translation initiation factor IF-2; Validated
637-796 1.40e-05

translation initiation factor IF-2; Validated


Pssm-ID: 235401  Cd Length: 746  Bit Score: 49.08  E-value: 1.40e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  637 EVKSPATVKSPVEAKSPAEvkspvtvksPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEA 716
Cdd:PRK05306   30 EVKSHSSTVEEEEARKEEA---------KREAEEEAKAEAEEAAAAEAEEEAKAEAAAAAPAEEAAEAAAAAEAAARPAE 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  717 KPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPE 796
Cdd:PRK05306  101 DEAARPAEAAARRPKAKKAAKKKKGPKPKKKKPKRKAARGGKRGKGGKGRRRRRGRRRRRKKKKKQKPTEKIPREVVIPE 180
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
566-739 1.42e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138  Cd Length: 647  Bit Score: 48.71  E-value: 1.42e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  566 AKSPAEAkSPAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAkspasvkSPGEAKSPAEAKSPAEVKSPATVK 645
Cdd:PRK07994  358 AFHPAAP-LPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPAS-------APQQAPAVPLPETTSQLLAARQQL 429
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  646 SPVEAKSPAEVKSPVTVKSPAEAKSPVEvkspaSVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSP 725
Cdd:PRK07994  430 QRAQGATKAKKSEPAAASRARPVNSALE-----RLASVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKALKKAL 504
                         170
                  ....*....|....
gi 158341642  726 AEAKSPAEAKSPAE 739
Cdd:PRK07994  505 EHEKTPELAAKLAA 518
CDC27 pfam09507
DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It ...
663-904 1.58e-05

DNA polymerase subunit Cdc27; This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.


Pssm-ID: 312868  Cd Length: 427  Bit Score: 48.28  E-value: 1.58e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   663 KSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSP-AEAKPPAEAKSPAEAKSPAEAKSPAEAK 741
Cdd:pfam09507  112 RDSLIYGAQAGPIVNPNVKRRSGLVPPPAPPASPPLETTAPGKTPPVAKQStKPPTGIMKSEFKAKSAAKSQDASKETTP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   742 SPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKsPMKEEAKSPEKAKTLDVKSPE 821
Cdd:pfam09507  192 EKAEKAPSVKAPSLKRSPSAKSNIMSAFFKAKPKNKKKKTLAKEQKVQEESAEQSGKE-DVKLEDASAADEDEPEQLPTK 270
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   822 AKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATPKTEVKE 901
Cdd:pfam09507  271 SQQRRRQKRGESSDKEEPTRETRKERRERLKKMMEDDDDDDEMEDVPESPVATEEEETSPPPPLLKKEVEKEEVTESGDG 350

                   ...
gi 158341642   902 SKK 904
Cdd:pfam09507  351 RRR 353
rad2 TIGR00600
DNA excision repair protein (rad2); All proteins in this family for which functions are known ...
421-869 1.71e-05

DNA excision repair protein (rad2); All proteins in this family for which functions are known are flap endonucleases that generate the 3' incision next to DNA damage as part of nucleotide excision repair. This family is related to many other flap endonuclease families including the fen1 family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273166  Cd Length: 1034  Bit Score: 48.74  E-value: 1.71e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   421 SLTEGLPKIPSMSTHIKVKSEEKIKVVEKSEKETVIVEEQT-EEIQVTEEVTEEEDKEAQGEEEEEAEEGGEEAA---TT 496
Cdd:TIGR00600  312 SLPSLSSQLDSNSEDLKSSPWEKLKPESESIVEAEPPSPRTlLAKQAAMSESSSEDSDESEWERQELKRNNVAFVddgSL 391
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   497 SPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSP---AEAK 573
Cdd:TIGR00600  392 SPRTLQAIGQALDDDEDKKVSASSDDQASPSKKTKMLLISRIEVEDDDLDYLDQGEGIPLMAALQLSSVNSKPeavASTK 471
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   574 SPAEVKSPATVKSPGEAKSPAEAKSPA-EVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKS 652
Cdd:TIGR00600  472 IAREVTSSGHEAVPKAVQSLLLGATNDsPIPSEFTILDRKSELSIERTVKPVSSEFGLPSQREDKLAIPTEGTQNLQGIS 551
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   653 PAEVKSPVTvkspaEAKSPVEVKSPASVKSpSEAKSPAGAKSPAEAKSPVvaKSPAEAKSPAEAKPPAEAKS---PAEAK 729
Cdd:TIGR00600  552 DHPEQFEFQ-----NELSPLETKNNESNLS-SDAETEGSPNPEMPSWSSV--TVPSEALDNYETTNPSNAKEvrnFAETG 623
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   730 SPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSP 809
Cdd:TIGR00600  624 IQTTNVGESADLLLISNPMEVEPMESEKEESESDGSFIEVDSVSSTLELQVPSKSQPTDESEENAENKVASIEGEHRKEI 703
                          410       420       430       440       450       460
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   810 EKaKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSPEKEETRTEKVAPKKEE 869
Cdd:TIGR00600  704 ED-LLFDESEEDNIVGMIEEEKDADDFKNEWQDISLEELEALEANLLAEQNSLKAQKQQQ 762
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
663-741 1.72e-05

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030  Cd Length: 1228  Bit Score: 48.73  E-value: 1.72e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 158341642  663 KSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAK 741
Cdd:PRK12270   40 STAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVEDEVT 118
Glutenin_hmw pfam03157
High molecular weight glutenin subunit; Members of this family include high molecular weight ...
523-763 1.73e-05

High molecular weight glutenin subunit; Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.


Pssm-ID: 281191  Cd Length: 772  Bit Score: 48.60  E-value: 1.73e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   523 EAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPAEV 602
Cdd:pfam03157  283 QGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQPGQGQPGYYP 362
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   603 KSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPatvKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKS---PAS 679
Cdd:pfam03157  363 TSPLQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKG---QQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPgyyPTS 439
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   680 VKSPSEAKSPAGAKSPAEAKSPVVAKSPAEaksPAEAKPPAEAKSPaeaKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAK 759
Cdd:pfam03157  440 PQQSGQGQQPGQWQQPGQGQPGYYPTSPLQ---PGQGQPGYDPTSP---QQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQ 513

                   ....
gi 158341642   760 SPVK 763
Cdd:pfam03157  514 QPAQ 517
pylS PRK09537
pyrolysyl-tRNA synthetase; Reviewed
509-598 2.04e-05

pyrolysyl-tRNA synthetase; Reviewed


Pssm-ID: 236555  Cd Length: 417  Bit Score: 47.91  E-value: 2.04e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  509 ETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPG 588
Cdd:PRK09537   88 EDKTQVKVKVVSAPTKKKKAMPKSVVRAPKPLENPVPAQAESSGSKPVPSIPVSTPEVKAPAPALTPSQKDRLETLLSPK 167
                          90
                  ....*....|
gi 158341642  589 EAKSPAEAKS 598
Cdd:PRK09537  168 DKISLNSEKP 177
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
497-883 2.41e-05

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 308660  Cd Length: 938  Bit Score: 48.17  E-value: 2.41e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   497 SPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSP-AVAKSPAEVKSPAEVKSPAEAKSPAEAKS- 574
Cdd:pfam03154  181 QQPAPTPATPLPSQTPPPMTSQPQPLPVASPSTITTATSTTTTSRVVSPvDPNPDPPSIIAPQSAQRGPEGPPTPQPHSl 260
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   575 --PAEVKSPATVKSPGEAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKS 652
Cdd:pfam03154  261 qgPPSFPGPAQGPGQGQGQSPPPPSLYPPHPNQLQSHPPSQGPHPTHSFPPKPVPLPPPPASAPQIKPPPTTPIPSSHKH 340
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   653 PAEVKSPVTVKSPAEAKSPVEVKSPASVKS--PSEAKSP-------AGAKSPAEAKSPVVAKSPAEAKSPAEA--KPPAE 721
Cdd:pfam03154  341 PPHLSASPFPQMPSNLPPPPALKPLASLPSqhPPCAQPPplqlmpqPHQLQPPPAQPPVLTQSQSHQVKGHHAspPPTTA 420
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   722 AKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKSPVKEE-----IKPPAEVKSPE 796
Cdd:pfam03154  421 ASHPSLSSTAPFPLSSASSVPGAVGPVPSPVPAMSGPQPSSSSALSVSTVPPQLTIKEEPLDEEeecesPPPPRRSPSPE 500
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   797 KAKSPMKEEA-KSPEKAKTLD------------------VKSPEAKTPAKEEAKRPADiRSPEQVKSPAKEEAKSPEKEE 857
Cdd:pfam03154  501 PTIVNIASHAsQSARFIKHLDrgynscartdlyftplasSKLAKKREEAAEKARREAE-QSARQERERERERERERERER 579
                          410       420
                   ....*....|....*....|....*.
gi 158341642   858 TRtEKVAPKKEEVKSPVEEVKAKEPP 883
Cdd:pfam03154  580 ER-EREADRAARASSSSHDGRMSEHP 604
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
678-795 2.51e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 48.17  E-value: 2.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  678 ASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKS---PAEAKPPAEakSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKS 754
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAaapAAAASAPAA--PPAAAPPAPVAAPAAAAPAAAPAAAPAAVAL 447
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 158341642  755 PEKAKSPVKEGAKSLAEAKSPEKAkSPVKEEIKPPAEVKSP 795
Cdd:PRK14951  448 APAPPAQAAPETVAIPVRVAPEPA-VASAAPAPAAAPAAAR 487
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
666-821 2.72e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138  Cd Length: 647  Bit Score: 47.94  E-value: 2.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  666 AEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAE 745
Cdd:PRK07994  366 PEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAKKSEPAA 445
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 158341642  746 AKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKS--PVKEEIKPPAEVKSPEKAKSPMKEEaKSPEKAKTLDVKSPE 821
Cdd:PRK07994  446 ASRARPVNSALERLASVRPAPSALEKAPAKKEAYRwkATNPVEVKKEPVATPKALKKALEHE-KTPELAAKLAAEAIE 522
PRK05035 PRK05035
electron transport complex protein RnfC; Provisional
500-729 2.80e-05

electron transport complex protein RnfC; Provisional


Pssm-ID: 235334  Cd Length: 695  Bit Score: 48.02  E-value: 2.80e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  500 AEEAASPEKETKSPVKEeAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVK 579
Cdd:PRK05035  474 KKAAEARAAKDKDAVAA-ALARVKAKKAAATQPIVIKAGARPDNSAVIAAREARKAQARARQAEKQAAAAADPKKAAVAA 552
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642  580 SPATVKspgeAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKspgeAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSP 659
Cdd:PRK05035  553 AIARAK----AKKAAQQAANAEAEEEVDPKKAAVAAAIARAK----AKKAAQQAASAEPEEQVAEVDPKKAAVAAAIARA 624
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 158341642  660 VTVKspAEAKSPVEVKSPASVKSPSEAKSPAGAKspaeAKSPVVAKSPAEAKSPAEAKP--PAEAKSPAEAK 729
Cdd:PRK05035  625 KAKK--AEQQANAEPEEPVDPRKAAVAAAIARAK----ARKAAQQQANAEPEEAEDPKKaaVAAAIARAKAK 690
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
608-916 2.84e-05

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904  Cd Length: 886  Bit Score: 47.99  E-value: 2.84e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   608 AKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAK---SPAEVKSPVTVKSPAEAkSPVeVKSPASVKSPS 684
Cdd:pfam05109  422 SKAPESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPASTGptvSTADVTSPTPAGTTSGA-SPV-TPSPSPRDNGT 499
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   685 EAKSPaGAKSPAEAkspVVAKSP-AEAKSPAEAKPPAEAKSPAEAK-SPAEA-KSPA-EAKSPAEAkspVEVKSPEKAKS 760
Cdd:pfam05109  500 ESKAP-DMTSPTSA---VTTPTPnATSPTPAVTTPTPNATSPTLGKtSPTSAvTTPTpNATSPTPA---VTTPTPNATIP 572
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   761 PVKEGAKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPE 840
Cdd:pfam05109  573 TLGKTSPTSAVTTPTPNATSPTVGETSPQANTTNHTLGGTSSTPVVTSPPKNATSAVTTGQHNITSSSTSSMSLRPSSIS 652
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158341642   841 QVKSPAKEEAKS----------PEKEETRTEkVAPkkeeVKSPVEEVKAKEP---PKKVEEEKTPATPKTEVKESK---- 903
Cdd:pfam05109  653 ETLSPSTSDNSTshmplltsahPTGGENITQ-VTP----ASTSTHHVSTSSPaprPGTTSQASGPGNSS