NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157412332|ref|NP_001098709|]
View 

epithelial membrane protein 2 precursor [Pan troglodytes]

Protein Classification

PMP22_Claudin domain-containing protein (domain architecture ID 10467089)

PMP22_Claudin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-160 4.89e-57

PMP-22/EMP/MP20/Claudin family;


:

Pssm-ID: 250157  Cd Length: 161  Bit Score: 179.10  E-value: 4.89e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332    1 MLVLLAFIIAFHITSAALLFIATIDNAWWVGDEF----FADVWRICTNNTNCTVINDS-FQEYSTLQAVQATMILSTILC 75
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCKvLELNDALQAVQALMILSIILG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332   76 CIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHHKNAKfypvTREGSYGYSYILAWVAFACTFI 155
Cdd:pfam00822  81 IISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFALAFI 156

                  ....*
gi 157412332  156 SGMMY 160
Cdd:pfam00822 157 GGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-160 4.89e-57

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 179.10  E-value: 4.89e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332    1 MLVLLAFIIAFHITSAALLFIATIDNAWWVGDEF----FADVWRICTNNTNCTVINDS-FQEYSTLQAVQATMILSTILC 75
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCKvLELNDALQAVQALMILSIILG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332   76 CIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHHKNAKfypvTREGSYGYSYILAWVAFACTFI 155
Cdd:pfam00822  81 IISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFALAFI 156

                  ....*
gi 157412332  156 SGMMY 160
Cdd:pfam00822 157 GGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
1-160 4.89e-57

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 179.10  E-value: 4.89e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332    1 MLVLLAFIIAFHITSAALLFIATIDNAWWVGDEF----FADVWRICTNNTNCTVINDS-FQEYSTLQAVQATMILSTILC 75
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVgaaaSAGLWRNCTTQSCTGQISCKvLELNDALQAVQALMILSIILG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332   76 CIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHHKNAKfypvTREGSYGYSYILAWVAFACTFI 155
Cdd:pfam00822  81 IISLIVFFFQLFTMRKGGRFKLAGIIFLVSGLCVLVGASIYTSRIATDFGNPFT----NRKYSFGYSFILGWVAFALAFI 156

                  ....*
gi 157412332  156 SGMMY 160
Cdd:pfam00822 157 GGVLY 161
Claudin_2 pfam13903
PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight ...
13-161 8.51e-04

PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight junctions between cells.


Pssm-ID: 316425  Cd Length: 191  Bit Score: 38.17  E-value: 8.51e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332   13 ITSAALLFIATIDNAWWVGDEFFADV------------WRICTNNTNCTVIND-----------------------SFQE 57
Cdd:pfam13903   1 ILAFALLLIAFATDYWLVLDVALTGNgsytclfahlglWRHCFKSEVDVDSDNqtrffgclnqvpnpfptfeeeivSFSV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412332   58 YSTL---QAVQATMILSTILCCIAFFIFVLQLFRLKQGeRFVLTSIIQLMSCLCVMIAASIYtdrREDIHHKNAKFYP-- 132
Cdd:pfam13903  81 TSLPgltRFVQAFAILSLVLIVCGVVCGLLALPKQSVF-LLLAAGILFLLSGVLGLLGVIVF---GQSVKLVFEEYFRqw 156
                         170       180       190
                  ....*....|....*....|....*....|....
gi 157412332  133 -----VTREGSYGYSYILAWVAFACTFISGMMYL 161
Cdd:pfam13903 157 mpehqNNVRISFGWSFALAWAGVVLSLLAGLLFL 190
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH