NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157412280|ref|NP_004665|]
View 

set1/Ash2 histone methyltransferase complex subunit ASH2 isoform a [Homo sapiens]

Protein Classification

PHD_ash2p_like and SPRY_Ash2 domain-containing protein (domain architecture ID 10204188)

PHD_ash2p_like and SPRY_Ash2 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SPRY_Ash2 cd12872
SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or ...
392-583 2.63e-76

SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or homeotic discs 2) -like proteins, core components of all mixed-lineage leukemia (MLL) family histone methyltransferases. Ash2 is a member of the trithorax group of transcriptional regulators of the Hox genes. Recent studies show that the SPRY domain of Ash2 mediates the interaction with RbBP5 and has an important role in regulating the methyltransferase activity of MLL complexes. In yeast, Ash2 is involved in histone methylation and is required for the earliest stages of embryogenesis.


:

Pssm-ID: 293932  Cd Length: 150  Bit Score: 243.19  E-value: 2.63e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 392 LKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMP--PDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFH 469
Cdd:cd12872    1 LKLSEDRLTVTGEKGYRMARANHGVREGKWYFEVKILEGGgtETGHVRVGWSRREASLQAPVGYDKYSYAIRDKDGSKFH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 470 QSIGKHYS-SGYGQGDVLGFYINLPedtetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphsEIIFYKNGV 548
Cdd:cd12872   81 QSRGKPYGePGFKEGDVIGFLITLP----------------------------------------------KIEFFKNGK 114
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 157412280 549 NQGVAYKDI-FEGVYFPAISLYKSCTVSINFGPCFK 583
Cdd:cd12872  115 SQGVAFEDIyGTGGYYPAVSLYKGATVTINFGPDFK 150
PHD_ash2p_like cd15583
PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and ...
101-150 8.93e-24

PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and similar proteins; spAsh2p, also termed Set1C component ash2, or COMPASS component ash2, or complex proteins associated with set1 protein ash2, or Lid2 complex component ash2, or Lid2C component ash2, is orthologous to Drosophila melanogaster Ash2 protein. Both spAsh2p and D. melanogaster Ash2 contain a plant homeodomain (PHD) finger and a SPRY domain. In contrast, its counterpart in Saccharomyces cerevisiae, Bre2p, has no PHD finger and is not included in this family. spAsh2p shows histone H3 Lys4 (H3K4) methyltransferase activity through its PHD finger. It also interacts with Lid2p in S. pombe. Human Ash2L contains an atypical PHD finger that lacks part of the Cys4HisCys3 signature characteristic of PHD fingers, it binds to only one zinc ion through the second half of the motif and does not have histone tail binding activity.


:

Pssm-ID: 277058  Cd Length: 50  Bit Score: 96.26  E-value: 8.93e-24
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 157412280 101 SVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVC 150
Cdd:cd15583    1 YCYCGKDRNLGEVELQCSICLKWFHAKCVSIDNGSCLPFMTNYQFVCKRC 50
 
Name Accession Description Interval E-value
SPRY_Ash2 cd12872
SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or ...
392-583 2.63e-76

SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or homeotic discs 2) -like proteins, core components of all mixed-lineage leukemia (MLL) family histone methyltransferases. Ash2 is a member of the trithorax group of transcriptional regulators of the Hox genes. Recent studies show that the SPRY domain of Ash2 mediates the interaction with RbBP5 and has an important role in regulating the methyltransferase activity of MLL complexes. In yeast, Ash2 is involved in histone methylation and is required for the earliest stages of embryogenesis.


Pssm-ID: 293932  Cd Length: 150  Bit Score: 243.19  E-value: 2.63e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 392 LKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMP--PDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFH 469
Cdd:cd12872    1 LKLSEDRLTVTGEKGYRMARANHGVREGKWYFEVKILEGGgtETGHVRVGWSRREASLQAPVGYDKYSYAIRDKDGSKFH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 470 QSIGKHYS-SGYGQGDVLGFYINLPedtetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphsEIIFYKNGV 548
Cdd:cd12872   81 QSRGKPYGePGFKEGDVIGFLITLP----------------------------------------------KIEFFKNGK 114
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 157412280 549 NQGVAYKDI-FEGVYFPAISLYKSCTVSINFGPCFK 583
Cdd:cd12872  115 SQGVAFEDIyGTGGYYPAVSLYKGATVTINFGPDFK 150
PHD_ash2p_like cd15583
PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and ...
101-150 8.93e-24

PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and similar proteins; spAsh2p, also termed Set1C component ash2, or COMPASS component ash2, or complex proteins associated with set1 protein ash2, or Lid2 complex component ash2, or Lid2C component ash2, is orthologous to Drosophila melanogaster Ash2 protein. Both spAsh2p and D. melanogaster Ash2 contain a plant homeodomain (PHD) finger and a SPRY domain. In contrast, its counterpart in Saccharomyces cerevisiae, Bre2p, has no PHD finger and is not included in this family. spAsh2p shows histone H3 Lys4 (H3K4) methyltransferase activity through its PHD finger. It also interacts with Lid2p in S. pombe. Human Ash2L contains an atypical PHD finger that lacks part of the Cys4HisCys3 signature characteristic of PHD fingers, it binds to only one zinc ion through the second half of the motif and does not have histone tail binding activity.


Pssm-ID: 277058  Cd Length: 50  Bit Score: 96.26  E-value: 8.93e-24
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 157412280 101 SVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVC 150
Cdd:cd15583    1 YCYCGKDRNLGEVELQCSICLKWFHAKCVSIDNGSCLPFMTNYQFVCKRC 50
SPRY smart00449
Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are ...
418-580 2.77e-23

Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.


Pssm-ID: 214669  Cd Length: 122  Bit Score: 96.98  E-value: 2.77e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280   418 KGAWYFEITVDEmppDTAARLGWSQPLGNL--QAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQ-GDVLGFYINLPE 494
Cdd:smart00449   1 SGRHYFEVEIGD---GGHWRVGVATKSVPRgyFALLGEDKGSWGYDGDGGKKYHNSTGPEYGLPLQEpGDVIGCFLDLEA 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280   495 DTetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVN-QGVAYKDI-FEGVYFPAISLYKSC 572
Cdd:smart00449  78 GT--------------------------------------------ISFYKNGKYlHGLAFFDVkFSGPLYPAFSLGSGN 113

                   ....*...
gi 157412280   573 TVSINFGP 580
Cdd:smart00449 114 SVRLNFGP 121
SPRY pfam00622
SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown ...
421-579 8.06e-14

SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologs are domains in butyrophilin/marenostrin/pyrin homologs.


Pssm-ID: 306974  Cd Length: 120  Bit Score: 69.67  E-value: 8.06e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280  421 WYFEITVDEmPPDTAARLGW---SQPLGNlQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG-YGQGDVLGFYINLPEDT 496
Cdd:pfam00622   2 HYFEVEVFG-QDGGGWRVGWatkDYPRKG-EGFLGNDSGSWGYDGWTGKKYWASTSPPTGLPlFEPGDVIGCFLDLEEGT 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280  497 etakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVNQGVAYKDI-FEGVYFPAISLYKSCTVS 575
Cdd:pfam00622  80 --------------------------------------------ISFTKNGKSLGYAFRDVpFAGPLFPAVSLGSGEGLQ 115

                  ....
gi 157412280  576 INFG 579
Cdd:pfam00622 116 FNFG 119
 
Name Accession Description Interval E-value
SPRY_Ash2 cd12872
SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or ...
392-583 2.63e-76

SPRY domain in Ash2; This SPRY domain is found at the C-terminus of Ash2 (absent, small, or homeotic discs 2) -like proteins, core components of all mixed-lineage leukemia (MLL) family histone methyltransferases. Ash2 is a member of the trithorax group of transcriptional regulators of the Hox genes. Recent studies show that the SPRY domain of Ash2 mediates the interaction with RbBP5 and has an important role in regulating the methyltransferase activity of MLL complexes. In yeast, Ash2 is involved in histone methylation and is required for the earliest stages of embryogenesis.


Pssm-ID: 293932  Cd Length: 150  Bit Score: 243.19  E-value: 2.63e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 392 LKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMP--PDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFH 469
Cdd:cd12872    1 LKLSEDRLTVTGEKGYRMARANHGVREGKWYFEVKILEGGgtETGHVRVGWSRREASLQAPVGYDKYSYAIRDKDGSKFH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 470 QSIGKHYS-SGYGQGDVLGFYINLPedtetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphsEIIFYKNGV 548
Cdd:cd12872   81 QSRGKPYGePGFKEGDVIGFLITLP----------------------------------------------KIEFFKNGK 114
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 157412280 549 NQGVAYKDI-FEGVYFPAISLYKSCTVSINFGPCFK 583
Cdd:cd12872  115 SQGVAFEDIyGTGGYYPAVSLYKGATVTINFGPDFK 150
PHD_ash2p_like cd15583
PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and ...
101-150 8.93e-24

PHD finger found in Schizosaccharomyces pombe Set1 complex component ash2 (spAsh2p) and similar proteins; spAsh2p, also termed Set1C component ash2, or COMPASS component ash2, or complex proteins associated with set1 protein ash2, or Lid2 complex component ash2, or Lid2C component ash2, is orthologous to Drosophila melanogaster Ash2 protein. Both spAsh2p and D. melanogaster Ash2 contain a plant homeodomain (PHD) finger and a SPRY domain. In contrast, its counterpart in Saccharomyces cerevisiae, Bre2p, has no PHD finger and is not included in this family. spAsh2p shows histone H3 Lys4 (H3K4) methyltransferase activity through its PHD finger. It also interacts with Lid2p in S. pombe. Human Ash2L contains an atypical PHD finger that lacks part of the Cys4HisCys3 signature characteristic of PHD fingers, it binds to only one zinc ion through the second half of the motif and does not have histone tail binding activity.


Pssm-ID: 277058  Cd Length: 50  Bit Score: 96.26  E-value: 8.93e-24
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 157412280 101 SVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVC 150
Cdd:cd15583    1 YCYCGKDRNLGEVELQCSICLKWFHAKCVSIDNGSCLPFMTNYQFVCKRC 50
SPRY smart00449
Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are ...
418-580 2.77e-23

Domain in SPla and the RYanodine Receptor; Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.


Pssm-ID: 214669  Cd Length: 122  Bit Score: 96.98  E-value: 2.77e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280   418 KGAWYFEITVDEmppDTAARLGWSQPLGNL--QAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQ-GDVLGFYINLPE 494
Cdd:smart00449   1 SGRHYFEVEIGD---GGHWRVGVATKSVPRgyFALLGEDKGSWGYDGDGGKKYHNSTGPEYGLPLQEpGDVIGCFLDLEA 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280   495 DTetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVN-QGVAYKDI-FEGVYFPAISLYKSC 572
Cdd:smart00449  78 GT--------------------------------------------ISFYKNGKYlHGLAFFDVkFSGPLYPAFSLGSGN 113

                   ....*...
gi 157412280   573 TVSINFGP 580
Cdd:smart00449 114 SVRLNFGP 121
SPRY_hnRNP cd12884
SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1; This domain, ...
381-579 1.36e-19

SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1; This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 (also known as HNRPUL1 ) which is a major constituent of nuclear matrix or scaffold and binds directly to DNA sequences through the N-terminal acidic region named serum amyloid P (SAP). Its function is specifically modulated by E1B-55kDa in adenovirus-infected cells. HNRPUL1 also participates in ATR protein kinase signaling pathways during adenovirus infection. Two transcript variants encoding different isoforms have been found for this gene. When associated with bromodomain-containing protein 7 (BRD7), it activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation.


Pssm-ID: 293942  Cd Length: 177  Bit Score: 88.03  E-value: 1.36e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 381 VLLALHDRAPQLKISDDRLTVV---GEKGYSM---VRASHGVRKGAWYFEITVDEMPPDTAA----------RLGWSQPL 444
Cdd:cd12884    1 VCLDTYNSDLHLKISKDRYSASpltDEGFAYLwagARATYGVTKGKVCFEVKVTENLPVKHLpteetdphvvRVGWSVDS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 445 GNLQapLGYDKFSYSWrSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLpeDTETAkslpdtykdkalikfksylyfeekd 524
Cdd:cd12884   81 SSLQ--LGEEEFSYGY-GSTGKKSTNCKFEDYGEPFGENDVIGCYLDF--ESEPV------------------------- 130
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 525 fvdkaekslkqtphsEIIFYKNGVNQGVAYKdIFEGVY-----FPAIsLYKSCTVSINFG 579
Cdd:cd12884  131 ---------------EISFSKNGKDLGVAFK-ISKEELggkalFPHV-LTKNCAVEVNFG 173
SPRY_DDX1 cd12873
SPRY domain associated with DEAD box gene DDX1; This SPRY domain is associated with the DEAD ...
387-579 1.67e-16

SPRY domain associated with DEAD box gene DDX1; This SPRY domain is associated with the DEAD box gene, DDX1, an RNA-dependent ATPase involved in HIV-1 Rev function and virus replication. It is suggested that DDX1 acts as a cellular cofactor by promoting oligomerization of Rev on the Rev response element (RRE). DDX1 RNA is overexpressed in breast cancer, data showing a strong and independent association between poor prognosis and deregulation of the DEAD box protein DDX1, thus potentially serving as an effective prognostic biomarker for early recurrence in primary breast cancer. DDX1 also interacts with RelA and enhances nuclear factor kappaB-mediated transcription. DEAD-box proteins are associated with all levels of RNA metabolism and function, and have been implicated in translation initiation, transcription, RNA splicing, ribosome assembly, RNA transport, and RNA decay.


Pssm-ID: 293933  Cd Length: 155  Bit Score: 78.38  E-value: 1.67e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 387 DRAPQLKISDDRLTV--VGEKGYSMVRASHGVR-KGAWYFEITVDEmppDTAARLGWSQPLGNLQapLGYDKFSYSWrSK 463
Cdd:cd12873    5 DRDAALAISPDGLLCqsREEKGWQGCRATKGVKgKGKYYYEVTVTD---EGLCRVGWSTEDASLD--LGTDKFGFGY-GG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 464 KGTKFHQSIGKHYSSGYGQGDVLGFYINLpedtetakslpdtykDKALIKfksylyfeekdfvdkaekslkqtphseiiF 543
Cdd:cd12873   79 TGKKSHGRQFDDYGEPFGLGDVIGCYLDL---------------DNGTIS-----------------------------F 114
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 157412280 544 YKNGVNQGVAYKDIFE---GVYFPAISLyKSCTVSINFG 579
Cdd:cd12873  115 SKNGKDLGKAFDIPPHlrnSALFPAVCL-KNAEVEFNFG 152
SPRY cd11709
SPRY domain; SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit ...
419-577 4.07e-16

SPRY domain; SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit Ryanodine receptor (hence the name), are homologous to B30.2. SPRY domains have been identified in at least 11 protein families, covering a wide range of functions, including regulation of cytokine signaling (SOCS), RNA metabolism (DDX1 and hnRNP), immunity to retroviruses (TRIM5alpha), intracellular calcium release (ryanodine receptors or RyR) and regulatory and developmental processes (HERC1 and Ash2L). B30.2 also contains residues in the N-terminus that form a distinct PRY domain structure; i.e. B30.2 domain consists of PRY and SPRY subdomains. B30.2 domains comprise the C-terminus of three protein families: BTNs (receptor glycoproteins of immunoglobulin superfamily); several TRIM proteins (composed of RING/B-box/coiled-coil or RBCC core); Stonutoxin (secreted poisonous protein of the stonefish Synanceia horrida). TRIM/RBCC proteins are involved in a variety of processes, including apoptosis, cell cycle regulation, cell growth, senescence, viral response, meiosis, cell differentiation, and vesicular transport. Genes belonging to this family are implicated in several human diseases that vary from cancer to rare genetic syndromes. The PRY-SPRY domain in these TRIM families is suggested to serve as the target binding site. While SPRY domains are evolutionarily ancient, B30.2 domains are a more recent adaptation where the SPRY/PRY combination is a possible component of immune defense. Mutations found in the SPRY-containing proteins have shown to cause Mediterranean fever and Opitz syndrome.


Pssm-ID: 293931  Cd Length: 118  Bit Score: 76.32  E-value: 4.07e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 419 GAWYFEITVDEMPPdTAARLGWSQPLGNLQA--PLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDT 496
Cdd:cd11709    1 GKWYWEVRVDSGNG-GLIQVGWATKSFSLDGegGVGDDEESWGYDGSRLRKGHGGSSGPGGRPWKSGDVVGCLLDLDEGT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 497 etakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVNQGVAYKDIFE--GVYFPAISLYKSCTV 574
Cdd:cd11709   80 --------------------------------------------LSFSLNGKDLGVAFTNLFLkgGGLYPAVSLGSGQGV 115

                 ...
gi 157412280 575 SIN 577
Cdd:cd11709  116 TIN 118
SPRY pfam00622
SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown ...
421-579 8.06e-14

SPRY domain; SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologs are domains in butyrophilin/marenostrin/pyrin homologs.


Pssm-ID: 306974  Cd Length: 120  Bit Score: 69.67  E-value: 8.06e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280  421 WYFEITVDEmPPDTAARLGW---SQPLGNlQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG-YGQGDVLGFYINLPEDT 496
Cdd:pfam00622   2 HYFEVEVFG-QDGGGWRVGWatkDYPRKG-EGFLGNDSGSWGYDGWTGKKYWASTSPPTGLPlFEPGDVIGCFLDLEEGT 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280  497 etakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVNQGVAYKDI-FEGVYFPAISLYKSCTVS 575
Cdd:pfam00622  80 --------------------------------------------ISFTKNGKSLGYAFRDVpFAGPLFPAVSLGSGEGLQ 115

                  ....
gi 157412280  576 INFG 579
Cdd:pfam00622 116 FNFG 119
SPRY_RanBP_like cd12885
SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3; This family includes SPRY ...
408-579 1.33e-12

SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3; This family includes SPRY domains found in Ran binding proteins (RBP or RanBPM) 9 and 10, SSH4 (suppressor of SHR3 null mutation protein 4), SPRY domain-containing protein 3 (SPRYD3) as well as HECT, a C-terminal catalytic domain of a subclass of ubiquitin-protein ligase (E3). RanBP9 and RanBP10 act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. The SPRY domain in SSH4 may be involved in cargo recognition, either directly or by combination with other adaptors, possibly leading to a higher selectivity. SPRYD3 is highly expressed in most tissues in humans, possibly involved in important cellular processes. HECT E3 mediates the direct transfer of ubiquitin from E2 to substrate.


Pssm-ID: 293943  Cd Length: 132  Bit Score: 66.53  E-value: 1.33e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 408 SMVRASHGV--RKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFH-QSIGKHYSSGYGQGD 484
Cdd:cd12885    1 GSVRADHPIppKVPVFYFEVTILDLGEKGIVSIGFCTSGFPLNRMPGWEDGSYGYHGDDGRVYLgGGEGENYGPPFGTGD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 485 VLGFYINLpedtetakslpdtykdkalikfksylyfeekdfvdkaekslkqtPHSEIIFYKNGVNQGVAYKDIFEGVYFP 564
Cdd:cd12885   81 VVGCGINF--------------------------------------------KTGEVFFTKNGELLGTAFENVVKGRLYP 116
                        170
                 ....*....|....*.
gi 157412280 565 AISL-YKSCTVSINFG 579
Cdd:cd12885  117 TVGLgSPGVKVRVNFG 132
SPRY2_RyR cd12878
SPRY domain 2 (SPRY2) of ryanodine receptor (RyR); This SPRY domain (SPRY2) is the second of ...
410-579 7.25e-10

SPRY domain 2 (SPRY2) of ryanodine receptor (RyR); This SPRY domain (SPRY2) is the second of three structural repeats in all three isoforms of the ryanodine receptor (RyR), which are the major Ca2+ release channels in the membranes of sarcoplasmic reticulum (SR). There are three RyR genes in mammals; the skeletal RyR1, the cardiac RyR2 and the brain RyR3. The three SPRY domains are located in the N-terminal part of the cytoplasmic region of the RyRs, The SPRY2 domain has been shown to bind to the dihydropryidine receptor (DHPR) II-III loop and the ASI region of RyR1


Pssm-ID: 240458  Cd Length: 133  Bit Score: 58.47  E-value: 7.25e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 410 VRASHGVRKGAWYFE---ITVDEMppdtaaRLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSiGKHYSSGYGQGDVL 486
Cdd:cd12878    5 AEKTYAVTSGKWYFEfevLTSGYM------RVGWARPGFRPDLELGSDDLSYAFDGFLARKWHQG-SESFGKQWQPGDVV 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 487 GFYINLPEDTetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGV----NQG--VAYKDIFEG 560
Cdd:cd12878   78 GCMLDLVDRT--------------------------------------------ISFTLNGEllidSSGseVAFKDIEIG 113
                        170       180
                 ....*....|....*....|
gi 157412280 561 V-YFPAISLYKSCTVSINFG 579
Cdd:cd12878  114 EgFVPACSLGVGQKGRLNLG 133
PHD_SF cd15489
PHD finger superfamily; The PHD finger superfamily includes a canonical plant homeodomain (PHD) ...
105-150 3.24e-07

PHD finger superfamily; The PHD finger superfamily includes a canonical plant homeodomain (PHD) finger typically characterized as Cys4HisCys3, and a non-canonical extended PHD finger, characterized as Cys2HisCys5HisCys2His. Variations include the RAG2 PHD finger characterized by Cys3His2Cys2His and the PHD finger 5 found in nuclear receptor-binding SET domain-containing proteins characterized by Cys4HisCys2His. The PHD finger is also termed LAP (leukemia-associated protein) motif or TTC (trithorax consensus) domain. Single or multiple copies of PHD fingers have been found in a variety of eukaryotic proteins involved in the control of gene transcription and chromatin dynamics. PHD fingers can recognize the unmodified and modified histone H3 tail, and some have been found to interact with non-histone proteins. They also function as epigenome readers controlling gene expression through molecular recruitment of multi-protein complexes of chromatin regulators and transcription factors. The PHD finger domain SF is structurally similar to the RING and FYVE_like superfamilies.


Pssm-ID: 276966  Cd Length: 48  Bit Score: 48.85  E-value: 3.24e-07
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 157412280 105 ENGRQLGEVELQCGICTKWFTADTFGIDTSSclpFMTNYSFHCNVC 150
Cdd:cd15489    6 GKGGDLGGELLQCDGCGKWFHADCLGPPLSS---FVPNGKWICPVC 48
SPRY_RNF123 cd12882
SPRY domain at N-terminus of ring finger protein 123; This SPRY domain is found at the ...
410-579 3.85e-07

SPRY domain at N-terminus of ring finger protein 123; This SPRY domain is found at the N-terminus of RING finger protein 123 domain (also known as E3 ubiquitin-protein ligase RNF123). The ring finger domain motif is present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. RNF123 displays E3 ubiquitin ligase activity toward the cyclin-dependent kinase inhibitor p27 (Kip1).


Pssm-ID: 293940  Cd Length: 128  Bit Score: 50.02  E-value: 3.85e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 410 VRASHGVRKGAWYFEITVDEMPpdtAARLGWSQP---------LGNLQAPLGYDkfsySWRSKKGTKFHQSIGKHYSSGy 480
Cdd:cd12882    2 IRANACVYKGKWMYEVTLGTKG---IMQIGWATIscrftqeegVGDTRDSYAYD----GNRVRKWNVSTQKYGEPWVAG- 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 481 gqgDVLGFYINLPEDTetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVNQGVAYKDIFEG 560
Cdd:cd12882   74 ---DVIGCCIDLDKGT--------------------------------------------ISFYRNGRSLGVAFDNVRRG 106
                        170       180
                 ....*....|....*....|..
gi 157412280 561 ---VYFPAISLYKSCTVSINFG 579
Cdd:cd12882  107 pglAYFPAVSLSFGERLELNFG 128
SPRY_RanBP9_10 cd12909
SPRY domain in Ran binding proteins 9 and 10; This family includes SPRY domain in Ran binding ...
410-579 8.70e-05

SPRY domain in Ran binding proteins 9 and 10; This family includes SPRY domain in Ran binding protein (RBP or RanBPM) 9 and 10, and similar proteins. RanBP9 (also known as RanBPM), a binding partner of Ran, is a small Ras-like GTPase that exerts multiple functions via interactions with various proteins. RanBP9 and RanBP10 also act as androgen receptor (AR) coactivators. Both consist of the N-terminal proline- and glutamine-rich regions, the SPRY domain, and LisH-CTLH and CRA motifs. SPRY domain of RanBPM forms a complex with CD39, a prototypic member of the NTPDase family, thus down-regulating activity substantially. RanBP10 enhances the transcriptional activity of AR in a ligand-dependent manner and exhibits a protein expression pattern different from RanBPM in various cell lines. RanBP10 is highly expressed in AR-positive prostate cancer LNCaP cells, while RanBPM is abundant in WI-38 and MCF-7 cells.


Pssm-ID: 293966  Cd Length: 144  Bit Score: 42.89  E-value: 8.70e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 410 VRASHGVRK--GAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQS-IGKHYSSGYGQGDVL 486
Cdd:cd12909   14 VRANHPIPPqcGIYYFEVKIISKGRDGYIGIGFSTKDVNLNRLPGWEPHSWGYHGDDGHSFCSSgTGKPYGPTFTTGDVI 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 487 GFYINlpedtetakslpdtykdkalikfksylyfeekdFVDKaekslkqtphseIIFY-KNGVNQGVAYKDIFEGVYFPA 565
Cdd:cd12909   94 GCGIN---------------------------------FRDN------------TAFYtKNGVNLGIAFRDIKKGNLYPT 128
                        170
                 ....*....|....*
gi 157412280 566 ISLYKSC-TVSINFG 579
Cdd:cd12909  129 VGLRTPGeHVEANFG 143
SPRY_like cd12886
SPRY domain-like in bacteria; This family contains SPRY-like domains that are found only in ...
419-579 1.88e-03

SPRY domain-like in bacteria; This family contains SPRY-like domains that are found only in bacterial and are mostly uncharacterized. SPRY domains, first identified in the SP1A kinase of Dictyostelium and rabbit Ryanodine receptor (hence the name), are homologous to B30.2. SPRY domains have been identified in at least 11 eukaryotic protein families, covering a wide range of functions, including regulation of cytokine signaling (SOCS), RNA metabolism (DDX1 and hnRNP), immunity to retroviruses (TRIM5alpha), intracellular calcium release (ryanodine receptors or RyR) and regulatory and developmental processes (HERC1 and Ash2L).


Pssm-ID: 293944  Cd Length: 129  Bit Score: 38.64  E-value: 1.88e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 419 GAWYFEITVDEMPPDTAARLGW---SQPLGNLQAPLGYDKFSYSWRSKKGTK-FHQSIGKHYSSGYGQGDVLGFYINLPE 494
Cdd:cd12886    1 GKWYWEVTVVSSAASTYAGIGVanaAATGNNGLNGIELSSIGYSLGVYSGNKlSNGSSVATYGAGFTAGDVIGVALDLDA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157412280 495 DTetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseIIFYKNGVNQGV------AYKDIFEGVYFPAISL 568
Cdd:cd12886   81 GK--------------------------------------------IWFYKNGVWQGGgdpapgTNPAFAGTAMYPAVTG 116
                        170
                 ....*....|...
gi 157412280 569 YKSC--TVSINFG 579
Cdd:cd12886  117 GSSTggSFTANFG 129
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH