NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|156231054|ref|NP_683734|]
View 

nuclear envelope pore membrane protein POM 121 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
292-527 4.48e-93

POM121 family;


:

Pssm-ID: 317613  Cd Length: 226  Bit Score: 300.05  E-value: 4.48e-93
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   292 KEKKKRTV-AEEDQLHLDGQENKRRRHDSGGSGHSAFEPLVANGVPAAFVPKPGSLKRSLASQSSDDHLNKRSRTSSVSS 370
Cdd:pfam15229    1 KESRKRTVkDEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   371 LasactggipsSSRNAITSSYSSTRGISQLWKRSGPTSSPFSSPASSRSQTPERPAKKTREEEPcQQSSSSPPLVTDKES 450
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 156231054   451 PGEKVTDTTTGKQQSSWTSPPTPGSSGQRKRKIQLLPSRRGDQLTLPPPPELGYSITAEDLDMERKASLQWFNKVLE 527
Cdd:pfam15229  150 QGEKAADTPPGKKQNSWSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
Atrophin-1 super family cl26464
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
422-707 1.01e-06

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 331285  Cd Length: 3151  Bit Score: 53.40  E-value: 1.01e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  422 PERPAKKTREEEPcqqssSSPPLVTDKESPGEKVTDTTTGKQQSSW---TSPPTPGSSGQRKRKIQLlpsRRGDQLTLPP 498
Cdd:PHA03247 2577 PSEPAVTSRARRP-----DAPPQSARPRAPVDDRGDPRGPAPPSPLppdTHAPDPPPPSPSPAANEP---DPHPPPTVPP 2648
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  499 PPELGYSITAEDLDMERKASLQ------------WFNKVLEDK--PDDASASATDGPPSTSPPFTFTLPAV----GPAAS 560
Cdd:PHA03247 2649 PERPRDDPAPGRVSRPRRARRLgraaqassppqrPRRRAARPTvgSLTSLADPPPPPPTPEPAPHALVSATplppGPAAA 2728
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  561 PASLPAPSSNPLLESLKKMQESPA--------PSSSEPAEAATVAAPSPPKTPSLLAPLVSPLAGPLASTSSDSKPAATF 632
Cdd:PHA03247 2729 RQASPALPAAPAPPAVPAGPATPGgparparpPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPP 2808
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 156231054  633 LGLASASSITPLTDSKSSGVSQAEQSVSTPASTASSPTPKPSMLFGMLSPPASSSSLATPAPACASPMFKPIFPA 707
Cdd:PHA03247 2809 AAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPV 2883
PTZ00473 super family cl26999
Plasmodium Vir superfamily; Provisional
1069-1170 3.83e-03

Plasmodium Vir superfamily; Provisional


The actual alignment was detected with superfamily member PTZ00473:

Pssm-ID: 240430  Cd Length: 420  Bit Score: 40.99  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054 1069 TPGTSSTSGTFSFGSGQSGTPGTTTSFGSLSQNTLGAPSQGSpFAFSVGSTPESKPVFGGTStptfGQSAPAPGVGTTGS 1148
Cdd:PTZ00473  316 GPYNANYGGQFNSRSGRTGSSESIRGFTYDSSTTYGGSSYGT-SQTDSTSTYGSRSTFDSST----GGGSQSGGGSTYGG 390
                          90       100
                  ....*....|....*....|..
gi 156231054 1149 SLSFGASSTPAQGFVGVGPFGS 1170
Cdd:PTZ00473  391 SSTFDGSSRGSSDSFGVSYFGP 412
 
Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
292-527 4.48e-93

POM121 family;


Pssm-ID: 317613  Cd Length: 226  Bit Score: 300.05  E-value: 4.48e-93
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   292 KEKKKRTV-AEEDQLHLDGQENKRRRHDSGGSGHSAFEPLVANGVPAAFVPKPGSLKRSLASQSSDDHLNKRSRTSSVSS 370
Cdd:pfam15229    1 KESRKRTVkDEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   371 LasactggipsSSRNAITSSYSSTRGISQLWKRSGPTSSPFSSPASSRSQTPERPAKKTREEEPcQQSSSSPPLVTDKES 450
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 156231054   451 PGEKVTDTTTGKQQSSWTSPPTPGSSGQRKRKIQLLPSRRGDQLTLPPPPELGYSITAEDLDMERKASLQWFNKVLE 527
Cdd:pfam15229  150 QGEKAADTPPGKKQNSWSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
PHA03247 PHA03247
large tegument protein UL36; Provisional
422-707 1.01e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 53.40  E-value: 1.01e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  422 PERPAKKTREEEPcqqssSSPPLVTDKESPGEKVTDTTTGKQQSSW---TSPPTPGSSGQRKRKIQLlpsRRGDQLTLPP 498
Cdd:PHA03247 2577 PSEPAVTSRARRP-----DAPPQSARPRAPVDDRGDPRGPAPPSPLppdTHAPDPPPPSPSPAANEP---DPHPPPTVPP 2648
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  499 PPELGYSITAEDLDMERKASLQ------------WFNKVLEDK--PDDASASATDGPPSTSPPFTFTLPAV----GPAAS 560
Cdd:PHA03247 2649 PERPRDDPAPGRVSRPRRARRLgraaqassppqrPRRRAARPTvgSLTSLADPPPPPPTPEPAPHALVSATplppGPAAA 2728
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  561 PASLPAPSSNPLLESLKKMQESPA--------PSSSEPAEAATVAAPSPPKTPSLLAPLVSPLAGPLASTSSDSKPAATF 632
Cdd:PHA03247 2729 RQASPALPAAPAPPAVPAGPATPGgparparpPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPP 2808
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 156231054  633 LGLASASSITPLTDSKSSGVSQAEQSVSTPASTASSPTPKPSMLFGMLSPPASSSSLATPAPACASPMFKPIFPA 707
Cdd:PHA03247 2809 AAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPV 2883
PTZ00473 PTZ00473
Plasmodium Vir superfamily; Provisional
1069-1170 3.83e-03

Plasmodium Vir superfamily; Provisional


Pssm-ID: 240430  Cd Length: 420  Bit Score: 40.99  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054 1069 TPGTSSTSGTFSFGSGQSGTPGTTTSFGSLSQNTLGAPSQGSpFAFSVGSTPESKPVFGGTStptfGQSAPAPGVGTTGS 1148
Cdd:PTZ00473  316 GPYNANYGGQFNSRSGRTGSSESIRGFTYDSSTTYGGSSYGT-SQTDSTSTYGSRSTFDSST----GGGSQSGGGSTYGG 390
                          90       100
                  ....*....|....*....|..
gi 156231054 1149 SLSFGASSTPAQGFVGVGPFGS 1170
Cdd:PTZ00473  391 SSTFDGSSRGSSDSFGVSYFGP 412
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
328-639 3.97e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039  Cd Length: 1352  Bit Score: 41.31  E-value: 3.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  328 EPLVANGVPAAFVPKPGSLKRSLASQSSDDHLNKRSRTSSVSSLASACTGGIPSSSRNAITSSYSSTRGISQLWKRSGPT 407
Cdd:PHA03307  127 PPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRP 206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  408 SSPFSSPASSRSQTPERPAKKTREEEPCQQSSSSPPLVTDKESPGEKVTDTTTGKQQSSWTSPPTPGSSGQRKRKIQLLP 487
Cdd:PHA03307  207 PRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPAS 286
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  488 SRRGDQLTLPPPPELGYSitAEDLDMERKASLQWfnkvlEDKPDDASASATDGPPSTSPpftftlPAVGPAASPASLPAP 567
Cdd:PHA03307  287 SSSSPRERSPSPSPSSPG--SGPAPSSPRASSSS-----SSSRESSSSSTSSSSESSRG------AAVSPGPSPSRSPSP 353
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 156231054  568 SSNPLLESLKKMQESPAPSSSEPAEAATVAAPSPPKTPSLLAPLVSPLAGPLASTSSDSKPAATFLGLASAS 639
Cdd:PHA03307  354 SRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGA 425
 
Name Accession Description Interval E-value
POM121 pfam15229
POM121 family;
292-527 4.48e-93

POM121 family;


Pssm-ID: 317613  Cd Length: 226  Bit Score: 300.05  E-value: 4.48e-93
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   292 KEKKKRTV-AEEDQLHLDGQENKRRRHDSGGSGHSAFEPLVANGVPAAFVPKPGSLKRSLASQSSDDHLNKRSRTSSVSS 370
Cdd:pfam15229    1 KESRKRTVkDEDDPSFTEGQDSKRRRPDSSGSAQSAFRPLVANGVPSSFVPKPGSLKRGLHSQSSEDSLNKRSRTSSMSS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054   371 LasactggipsSSRNAITSSYSSTRGISQLWKRSGPTSSPFSSPASSRSQTPERPAKKTREEEPcQQSSSSPPLVTDKES 450
Cdd:pfam15229   81 C----------SKRNAITSSYSSTRGFPQLRKRSGPSSSPLSSPASSRSQTPERPAKKAREEEG-PQSSSSAPLKSDKES 149
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 156231054   451 PGEKVTDTTTGKQQSSWTSPPTPGSSGQRKRKIQLLPSRRGDQLTLPPPPELGYSITAEDLDMERKASLQWFNKVLE 527
Cdd:pfam15229  150 QGEKAADTPPGKKQNSWSSPPTPGSSRPRKRKIPLLPSRRGDPLTLPPPPQLGYRVTAEDLDLEKKAAIQWINKVLE 226
PHA03247 PHA03247
large tegument protein UL36; Provisional
422-707 1.01e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 53.40  E-value: 1.01e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  422 PERPAKKTREEEPcqqssSSPPLVTDKESPGEKVTDTTTGKQQSSW---TSPPTPGSSGQRKRKIQLlpsRRGDQLTLPP 498
Cdd:PHA03247 2577 PSEPAVTSRARRP-----DAPPQSARPRAPVDDRGDPRGPAPPSPLppdTHAPDPPPPSPSPAANEP---DPHPPPTVPP 2648
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  499 PPELGYSITAEDLDMERKASLQ------------WFNKVLEDK--PDDASASATDGPPSTSPPFTFTLPAV----GPAAS 560
Cdd:PHA03247 2649 PERPRDDPAPGRVSRPRRARRLgraaqassppqrPRRRAARPTvgSLTSLADPPPPPPTPEPAPHALVSATplppGPAAA 2728
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  561 PASLPAPSSNPLLESLKKMQESPA--------PSSSEPAEAATVAAPSPPKTPSLLAPLVSPLAGPLASTSSDSKPAATF 632
Cdd:PHA03247 2729 RQASPALPAAPAPPAVPAGPATPGgparparpPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPP 2808
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 156231054  633 LGLASASSITPLTDSKSSGVSQAEQSVSTPASTASSPTPKPSMLFGMLSPPASSSSLATPAPACASPMFKPIFPA 707
Cdd:PHA03247 2809 AAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPV 2883
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
529-671 2.30e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865  Cd Length: 618  Bit Score: 48.56  E-value: 2.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  529 KPDDASASATDGPPSTSPPFTFTLPAVGPAASPASLPAPssnplleslkkmQESPAPSSSEPAEAATVAAPSPPKTPSLL 608
Cdd:PRK14951  365 KPAAAAEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAP------------AAAPAAAASAPAAPPAAAPPAPVAAPAAA 432
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 156231054  609 APLVSPLAGPLASTSSDSKPAATflgLASASSITPLTDSKSSGVSQAEQSVSTPASTASSPTP 671
Cdd:PRK14951  433 APAAAPAAAPAAVALAPAPPAQA---APETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTE 492
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
526-672 2.46e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874  Cd Length: 614  Bit Score: 48.23  E-value: 2.46e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  526 LEDKPDDASASaTDGPPSTSPPFTFTLPAVGPAASPASLPAPSSNPLLESlkkmqeSPAPSSSEPAEAATVAAPSPPKTP 605
Cdd:PRK14971  362 LTQKGDDASGG-RGPKQHIKPVFTQPAAAPQPSAAAAASPSPSQSSAAAQ------PSAPQSATQPAGTPPTVSVDPPAA 434
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 156231054  606 SLLAPLVSPLAGPLASTSSDSKPAATFLglasASSITPLTdskSSGVSQAEQSVSTPASTASSPTPK 672
Cdd:PRK14971  435 VPVNPPSTAPQAVRPAQFKEEKKIPVSK----VSSLGPST---LRPIQEKAEQATGNIKEAPTGTQK 494
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
529-631 1.05e-04

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030  Cd Length: 1228  Bit Score: 46.42  E-value: 1.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  529 KPDDASASATDGPPSTSPPftfTLPAVGPAASPASLPAPSSNPLLESLKKMQESPAPSSSEPAEAATVAAPSPPKTPSLL 608
Cdd:PRK12270   37 GPGSTAAPTAAAAAAAAAA---SAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAV 113
                          90       100
                  ....*....|....*....|....*...
gi 156231054  609 APLVSPLAGPLAST-----SSDSKPAAT 631
Cdd:PRK12270  114 EDEVTPLRGAAAAVaknmdASLEVPTAT 141
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
530-630 1.08e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138  Cd Length: 647  Bit Score: 42.93  E-value: 1.08e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  530 PDDASASATDGPPSTSPPFTFTLPAVGPAASPASLPAPSSNPLLESLKKM--QESPAPSSSEPAEAATVAAPSPPKTPSL 607
Cdd:PRK07994  376 APAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAArqQLQRAQGATKAKKSEPAAASRARPVNSA 455
                          90       100
                  ....*....|....*....|...
gi 156231054  608 LAPLVSPLAGPLASTSSDSKPAA 630
Cdd:PRK07994  456 LERLASVRPAPSALEKAPAKKEA 478
PTZ00473 PTZ00473
Plasmodium Vir superfamily; Provisional
1069-1170 3.83e-03

Plasmodium Vir superfamily; Provisional


Pssm-ID: 240430  Cd Length: 420  Bit Score: 40.99  E-value: 3.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054 1069 TPGTSSTSGTFSFGSGQSGTPGTTTSFGSLSQNTLGAPSQGSpFAFSVGSTPESKPVFGGTStptfGQSAPAPGVGTTGS 1148
Cdd:PTZ00473  316 GPYNANYGGQFNSRSGRTGSSESIRGFTYDSSTTYGGSSYGT-SQTDSTSTYGSRSTFDSST----GGGSQSGGGSTYGG 390
                          90       100
                  ....*....|....*....|..
gi 156231054 1149 SLSFGASSTPAQGFVGVGPFGS 1170
Cdd:PTZ00473  391 SSTFDGSSRGSSDSFGVSYFGP 412
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
328-639 3.97e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039  Cd Length: 1352  Bit Score: 41.31  E-value: 3.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  328 EPLVANGVPAAFVPKPGSLKRSLASQSSDDHLNKRSRTSSVSSLASACTGGIPSSSRNAITSSYSSTRGISQLWKRSGPT 407
Cdd:PHA03307  127 PPSPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRP 206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  408 SSPFSSPASSRSQTPERPAKKTREEEPCQQSSSSPPLVTDKESPGEKVTDTTTGKQQSSWTSPPTPGSSGQRKRKIQLLP 487
Cdd:PHA03307  207 PRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPAS 286
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  488 SRRGDQLTLPPPPELGYSitAEDLDMERKASLQWfnkvlEDKPDDASASATDGPPSTSPpftftlPAVGPAASPASLPAP 567
Cdd:PHA03307  287 SSSSPRERSPSPSPSSPG--SGPAPSSPRASSSS-----SSSRESSSSSTSSSSESSRG------AAVSPGPSPSRSPSP 353
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 156231054  568 SSNPLLESLKKMQESPAPSSSEPAEAATVAAPSPPKTPSLLAPLVSPLAGPLASTSSDSKPAATFLGLASAS 639
Cdd:PHA03307  354 SRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGA 425
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
533-759 7.62e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 40.22  E-value: 7.62e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  533 ASASATDGPPSTSPPFTFTLPAVGPAASPASLPAPSSNPLLESLKKMQESPAPSSSePAEAATVAAPSPPKTPSLLAPlv 612
Cdd:PRK07003  418 AAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPAD-SGSASAPASDAPPDAAFEPAP-- 494
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156231054  613 sPLAGPLASTSSDSKPAATfLGLASASSITPLTDSKSSGVSQAEQSVSTPASTASSPTPKPSML--FGMLSPPASSSSLA 690
Cdd:PRK07003  495 -RAAAPSAATPAAVPDARA-PAAASREDAPAAAAPPAPEARPPTPAAAAPAARAGGAAAALDVLrnAGMRVSSDRGARAA 572
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 156231054  691 TPAPACASPMFKPIFPATPKSESDSPLPSSSSAATTASSSTAPPTAASTTPTFKPIFDKMEPFTAMPLS 759
Cdd:PRK07003  573 AAAKPAAAPAAAPKPAAPRVAVQVPTPRARAATGDAPPNGAARAEQAAESRGAPPPWEDIPPDDYVPLS 641
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH