NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15597994|ref|NP_251488|]
View 

two-component response regulator [Pseudomonas aeruginosa PAO1]

Protein Classification

REC and RsbU domain-containing protein (domain architecture ID 11520393)

REC and RsbU domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
93-393 4.33e-50

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


:

Pssm-ID: 225118  Cd Length: 367  Bit Score: 175.28  E-value: 4.33e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRaylRVENQRYRDKLEAANRELQASLNLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208  68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 173 SIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYESrrngtlpEFKPSEVLA 252
Cdd:COG2208 145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESG-------PLDPADVLE 217
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 253 HINRGLINTK-LGKHVTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQA--GYLEGRGLPVGLFDDATYDDRVMELPPSF 329
Cdd:COG2208 218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 330 SLSLFSDGILDVLPGATLKEKEASLPEQVA------AAGGTLDGLRQVFGLANLAEMPDDIALLVLSRNL 393
Cdd:COG2208 298 LLVLYTDGVTEARNSDGEFFGLERLLKILGrllgqpAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 8.54e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 129.23  E-value: 8.54e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGV 88
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....
gi 15597994  89 MSDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
 
Name Accession Description Interval E-value
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
93-393 4.33e-50

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 175.28  E-value: 4.33e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRaylRVENQRYRDKLEAANRELQASLNLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208  68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 173 SIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYESrrngtlpEFKPSEVLA 252
Cdd:COG2208 145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESG-------PLDPADVLE 217
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 253 HINRGLINTK-LGKHVTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQA--GYLEGRGLPVGLFDDATYDDRVMELPPSF 329
Cdd:COG2208 218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 330 SLSLFSDGILDVLPGATLKEKEASLPEQVA------AAGGTLDGLRQVFGLANLAEMPDDIALLVLSRNL 393
Cdd:COG2208 298 LLVLYTDGVTEARNSDGEFFGLERLLKILGrllgqpAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 8.54e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 129.23  E-value: 8.54e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGV 88
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....
gi 15597994  89 MSDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
5-145 3.62e-34

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114  Cd Length: 464  Bit Score: 132.44  E-value: 3.62e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:COG2204   4 MARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMT 83
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15597994  85 GAGVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQRYRDKLEAANREL 145
Cdd:COG2204  84 GHGDIDTAVEALRLGAFDFLEKPF-DLDRLLAIVERALELRELQRENRRSLKRAKSLGGEL 143
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
9-119 3.28e-33

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 306560  Cd Length: 111  Bit Score: 121.87  E-value: 3.28e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGV 88
Cdd:pfam00072   2 LIVDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPTTPVIILTAHGD 81
                          90       100       110
                  ....*....|....*....|....*....|.
gi 15597994    89 MSDAVEALRLGAADYLIKPlEDLAVLEHSVR 119
Cdd:pfam00072  82 EDDAVEALEAGADDFLSKP-FDPDELLAAIR 111
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
201-391 6.39e-32

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 120.82  E-value: 6.39e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   201 ERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYEsrrngtlpEFKPSEVLAHINRGLI-NTKLGKHVTMLGGVIDLEKN 279
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAE--------GLDPAEVLKRLNRLLQrNLEEDMFATAVLAVYDPETG 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   280 SLTYSIGGHLPlPVLF--VEGQAGYLEGRGLPVGLFDDATYDDRVMELPPSFSLSLFSDGILDVL-PGATLKEKEASLP- 355
Cdd:pfam07228  73 TLEYANAGHPP-PLLLrpDGGVVELLESTGLPLGILPDADYEVVELELEPGDTLLLYTDGLTEARdPDGELFGLERLLAl 151
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 15597994   356 ---EQVAAAGGTLDGLRQVFGLANLAEMPDDIALLVLSR 391
Cdd:pfam07228 152 laeRHGLPPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PRK10693 PRK10693
response regulator of RpoS; Provisional
34-272 1.98e-28

response regulator of RpoS; Provisional


Pssm-ID: 182652  Cd Length: 303  Bit Score: 113.55  E-value: 1.98e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   34 QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGVMSDAVEALRLGAADYLIKPLEDLAV 113
Cdd:PRK10693   2 LAANGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATENMADIAKALRLGVQDVLLKPVKDLNR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  114 LEHSVRRALDRAY----LRVENQRYRDkLEAANRELQASLNLLQEDQNAGRQVqmnmlpvtpwsIEGLEFSHRIIPSLYL 189
Cdd:PRK10693  82 LREMVFACLYPSMfnsrVEEEERLFRD-WDALVDNPAAAAKLLKQLQPPVQQV-----------IAHCRVNYRQLVAADK 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  190 SGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYE--SRRNGTLPEFkpSEVLAHINRGLINTKLGKHV 267
Cdd:PRK10693 150 PGLVLDIAALSDNDLAFYCLDVTRAGDNGVLAALLLRALFNGLLQEqlAHQNQRLPEL--GALLKQVNHLLRQANLPGQF 227

                 ....*
gi 15597994  268 TMLGG 272
Cdd:PRK10693 228 PLLVG 232
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
7-140 3.28e-25

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099  Cd Length: 457  Bit Score: 106.09  E-value: 3.28e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGA 86
Cdd:PRK11361   6 RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAY 85
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15597994   87 GVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQRYRDKLEA 140
Cdd:PRK11361  86 AEVETAVEALRCGAFDYVIKPF-DLDELNLIVQRALQLQSMKKEIRHLHQALST 138
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
4-121 1.80e-18

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209  Cd Length: 226  Bit Score: 83.53  E-value: 1.80e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     4 VSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTAS--ETPII 81
Cdd:TIGR02154   1 MTRRILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPEtrAIPII 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 15597994    82 VLSGAGVMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRRA 121
Cdd:TIGR02154  81 MLTARGEEEDRVRGLETGADDYITKPFsprELLARIKAVLRRI 123
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
7-60 3.91e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.90  E-value: 3.91e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 15597994      7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMP 60
Cdd:smart00448   2 RILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
176-350 4.70e-13

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 67.37  E-value: 4.70e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    176 GLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMtTRLLYESRRNgtlpefkPSEVLAHIN 255
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSA-LRTLLSEGIS-------LSQILERLN 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    256 RGLINTKLGKH-VTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQAGY-LEGRGLPVGLFDDATYDDRVMELPPSFSLSL 333
Cdd:smart00331  75 RAIYENGEDGMfATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEdLDDLGAPLGLEPDVEVDVRELTLEPGDLLLL 154
                          170
                   ....*....|....*..
gi 15597994    334 FSDGILDVLPGATLKEK 350
Cdd:smart00331 155 YTDGLTEARNPERLEEL 171
 
Name Accession Description Interval E-value
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
93-393 4.33e-50

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 175.28  E-value: 4.33e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  93 VEALRLGAADYLIKPLEDLAVLEHSVRRALDRaylRVENQRYRDKLEAANRELQASLNLLQEDQNAGRQVQMNMLPVTPW 172
Cdd:COG2208  68 PVEVLLGVSGKLRALSEEIKHWRGGLPLVAEL---LVEINRAVGLVSAHNELLLLEQNNISAELEVARQIQQNLLPKALP 144
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 173 SIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYESrrngtlpEFKPSEVLA 252
Cdd:COG2208 145 LFPGIDIEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESG-------PLDPADVLE 217
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 253 HINRGLINTK-LGKHVTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQA--GYLEGRGLPVGLFDDATYDDRVMELPPSF 329
Cdd:COG2208 218 TLNRVLKQNLeEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIevEDLTALGLPIGLLPDYQYEVASLQLEPGD 297
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994 330 SLSLFSDGILDVLPGATLKEKEASLPEQVA------AAGGTLDGLRQVFGLANLAEMPDDIALLVLSRNL 393
Cdd:COG2208 298 LLVLYTDGVTEARNSDGEFFGLERLLKILGrllgqpAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
9-122 8.54e-36

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 129.23  E-value: 8.54e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGV 88
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....
gi 15597994  89 MSDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPF-SPEELLARIRALL 113
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
5-145 3.62e-34

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114  Cd Length: 464  Bit Score: 132.44  E-value: 3.62e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:COG2204   4 MARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMT 83
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15597994  85 GAGVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQRYRDKLEAANREL 145
Cdd:COG2204  84 GHGDIDTAVEALRLGAFDFLEKPF-DLDRLLAIVERALELRELQRENRRSLKRAKSLGGEL 143
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
9-119 3.28e-33

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 306560  Cd Length: 111  Bit Score: 121.87  E-value: 3.28e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGV 88
Cdd:pfam00072   2 LIVDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPTTPVIILTAHGD 81
                          90       100       110
                  ....*....|....*....|....*....|.
gi 15597994    89 MSDAVEALRLGAADYLIKPlEDLAVLEHSVR 119
Cdd:pfam00072  82 EDDAVEALEAGADDFLSKP-FDPDELLAAIR 111
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
201-391 6.39e-32

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 120.82  E-value: 6.39e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   201 ERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYEsrrngtlpEFKPSEVLAHINRGLI-NTKLGKHVTMLGGVIDLEKN 279
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAE--------GLDPAEVLKRLNRLLQrNLEEDMFATAVLAVYDPETG 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   280 SLTYSIGGHLPlPVLF--VEGQAGYLEGRGLPVGLFDDATYDDRVMELPPSFSLSLFSDGILDVL-PGATLKEKEASLP- 355
Cdd:pfam07228  73 TLEYANAGHPP-PLLLrpDGGVVELLESTGLPLGILPDADYEVVELELEPGDTLLLYTDGLTEARdPDGELFGLERLLAl 151
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 15597994   356 ---EQVAAAGGTLDGLRQVFGLANLAEMPDDIALLVLSR 391
Cdd:pfam07228 152 laeRHGLPPEELLDALLEALLRLGGGELEDDITLLVLRV 190
PRK10693 PRK10693
response regulator of RpoS; Provisional
34-272 1.98e-28

response regulator of RpoS; Provisional


Pssm-ID: 182652  Cd Length: 303  Bit Score: 113.55  E-value: 1.98e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   34 QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGVMSDAVEALRLGAADYLIKPLEDLAV 113
Cdd:PRK10693   2 LAANGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATENMADIAKALRLGVQDVLLKPVKDLNR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  114 LEHSVRRALDRAY----LRVENQRYRDkLEAANRELQASLNLLQEDQNAGRQVqmnmlpvtpwsIEGLEFSHRIIPSLYL 189
Cdd:PRK10693  82 LREMVFACLYPSMfnsrVEEEERLFRD-WDALVDNPAAAAKLLKQLQPPVQQV-----------IAHCRVNYRQLVAADK 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  190 SGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYE--SRRNGTLPEFkpSEVLAHINRGLINTKLGKHV 267
Cdd:PRK10693 150 PGLVLDIAALSDNDLAFYCLDVTRAGDNGVLAALLLRALFNGLLQEqlAHQNQRLPEL--GALLKQVNHLLRQANLPGQF 227

                 ....*
gi 15597994  268 TMLGG 272
Cdd:PRK10693 228 PLLVG 232
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
1-125 4.39e-27

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 105.31  E-value: 4.39e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   1 MHKVSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNG-LQGLQIFESE-QPDLVICDLRMPQIDGLELIRRIRQTASET 78
Cdd:COG0784   1 LLLSGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGeEEALELLRELpQPDLILLDINMPGMDGIELLRRLRARGPNI 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 15597994  79 PIIVLSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEHSVRRALDRA 125
Cdd:COG0784  81 PVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARA 127
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
1-139 9.37e-26

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095  Cd Length: 475  Bit Score: 107.83  E-value: 9.37e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   1 MHKVsatlLIIDDDEVVRESLAAYLEDSNFK---VLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASE 77
Cdd:COG4753   1 MYKV----LIVDDEPLIREGLKSLIDWEALGievVGTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPD 76
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15597994  78 TPIIVLSGAGVMSDAVEALRLGAADYLIKPL--EDL-AVLEHsVRRALDRAylRVENQRYRDKLE 139
Cdd:COG4753  77 TEFIILSGYDEFEYAKKAMKLGVKDYLLKPVdkAELeEALKK-IIGKLEEQ--QKVKQDIEKLLT 138
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
8-133 2.04e-25

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816  Cd Length: 229  Bit Score: 103.53  E-value: 2.04e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFEsEQPDLVICDLRMPQIDGLELIRRIRQTA-SETPIIVLSGA 86
Cdd:COG0745   3 ILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAR-EQPDLVLLDLMLPDLDGLELCRRLRAKKgSGPPIIVLTAR 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 15597994  87 GVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQR 133
Cdd:COG0745  82 DDEEDRVLGLEAGADDYLTKPF-SPRELLARLRALLRRNAGASRAEA 127
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
7-140 3.28e-25

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099  Cd Length: 457  Bit Score: 106.09  E-value: 3.28e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGA 86
Cdd:PRK11361   6 RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAY 85
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15597994   87 GVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQRYRDKLEA 140
Cdd:PRK11361  86 AEVETAVEALRCGAFDYVIKPF-DLDELNLIVQRALQLQSMKKEIRHLHQALST 138
fixJ PRK09390
response regulator FixJ; Provisional
5-125 3.17e-24

response regulator FixJ; Provisional


Pssm-ID: 181815  Cd Length: 202  Bit Score: 99.31  E-value: 3.17e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSNFKVlqalnglqglQIFESEQ------PDL----VICDLRMPQIDGLELIRRIRQT 74
Cdd:PRK09390   3 KGVVHVVDDDEAMRDSLAFLLDSAGFEV----------RLFESAQafldalPGLrfgcVVTDVRMPGIDGIELLRRLKAR 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 15597994   75 ASETPIIVLSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEhSVRRALDRA 125
Cdd:PRK09390  73 GSPLPVIVMTGHGDVPLAVEAMKLGAVDFIEKPFEDERLIG-AIERALAQA 122
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
8-148 6.17e-24

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229  Cd Length: 435  Bit Score: 102.02  E-value: 6.17e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA--SETPIIVLSG 85
Cdd:COG3706 135 ILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLRQLErtRDIPIILLSS 214
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15597994  86 AGVMSDAVEALRLGAADYLIKPLEDlAVLEHSVRRALDRAylrvenqRYRDKLEAANRELQAS 148
Cdd:COG3706 215 KDDDELVVRAFELGVNDYITKPIEE-GELRARLRRQLRRK-------RYERQLRESLERLQEL 269
FixJ COG4566
Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal ...
5-150 6.00e-23

Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226932  Cd Length: 202  Bit Score: 95.82  E-value: 6.00e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:COG4566   4 EPLVHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLELQDRLAERGIRLPVIFLT 83
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 15597994  85 GAGVMSDAVEALRLGAADYLIKPLEDLAVLEhSVRRALDRAYLRVEnqryRDKLEAANRELQASLN 150
Cdd:COG4566  84 GHGDIPMAVQAMKAGAVDFLEKPFSEQDLLD-AVERALARDASRRA----EADRQAAIRARLATLT 144
CitB COG2197
DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal ...
8-122 1.91e-22

DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 225107  Cd Length: 211  Bit Score: 94.29  E-value: 1.91e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   8 LLIIDDDEVVRESLAAYLE-DSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSG 85
Cdd:COG2197   3 VLIVDDHPLVREGLRQLLElEPDLEVVgEASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLTA 82
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 15597994  86 AGVMSDAVEALRLGAADYLIKPlEDLAVLEHSVRRAL 122
Cdd:COG2197  83 HDDPAYVIRALRAGADGYLLKD-ASPEELVEAIRAVA 118
orf27 CHL00148
Ycf27; Reviewed
1-137 6.92e-22

Ycf27; Reviewed


Pssm-ID: 214376  Cd Length: 240  Bit Score: 93.63  E-value: 6.92e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    1 MHKVSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRqTASETPI 80
Cdd:CHL00148   2 MENSKEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIR-KESDVPI 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 15597994   81 IVLSGAGVMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRAYLRVENQRYRDK 137
Cdd:CHL00148  81 IMLTALGDVSDRITGLELGADDYVVKPFS-PKELEARIRSVLRRTNKKSFSSKIPNS 136
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
1-139 7.29e-20

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971  Cd Length: 360  Bit Score: 89.73  E-value: 7.29e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   1 MHKVSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASET-- 78
Cdd:COG3437  10 EPDEKLTVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMSPSTrr 89
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 15597994  79 -PIIVLSGAGVMSDAVEALRLGAADYLIKPLE---------DLAVLEHSVRRALDRAyLRVENQRYRDKLE 139
Cdd:COG3437  90 iPVILLTAYADSEDRQRALEAGADDYLSKPISpkelvarvsSHLQLKRNEDFLLDQN-LYLELQELRRRTE 159
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms] ...
7-160 1.37e-18

Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms];


Pssm-ID: 226931  Cd Length: 224  Bit Score: 83.84  E-value: 1.37e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   7 TLLIIDDDEVVRESLAAYLEDSN-FK-VLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:COG4565   2 NVLIIEDDPMVAEIHRRYVKQIPgFSvVGTAGTLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELRSQHYPVDVIVIT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  85 GAGVMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRaldraYlrvenQRYRDKLEAAN----RELQASLNLLQEDQNAGR 160
Cdd:COG4565  82 AASDMETIKEALRYGVVDYLIKPFT-FERLQQALTR-----Y-----RQKRHALESHQqlsqKELDQLFNIQSKEQPPDD 150
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
4-121 1.80e-18

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209  Cd Length: 226  Bit Score: 83.53  E-value: 1.80e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     4 VSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTAS--ETPII 81
Cdd:TIGR02154   1 MTRRILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPEtrAIPII 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 15597994    82 VLSGAGVMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRRA 121
Cdd:TIGR02154  81 MLTARGEEEDRVRGLETGADDYITKPFsprELLARIKAVLRRI 123
COG4567 COG4567
Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains ...
1-107 3.53e-18

Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226933  Cd Length: 182  Bit Score: 82.09  E-value: 3.53e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   1 MHKVSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPI 80
Cdd:COG4567   5 MIGPDKSLLLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGLAVIEALRERRADMRI 84
                        90       100
                ....*....|....*....|....*..
gi 15597994  81 IVLSGAGVMSDAVEALRLGAADYLIKP 107
Cdd:COG4567  85 VVLTGYASIATAVEAVKLGACDYLAKP 111
ompR PRK09468
osmolarity response regulator; Provisional
8-120 1.42e-17

osmolarity response regulator; Provisional


Pssm-ID: 181883  Cd Length: 239  Bit Score: 81.17  E-value: 1.42e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK09468   8 ILVVDDDMRLRALLERYLTEQGFQVRSAANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQNNPTPIIMLTAKG 87
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 15597994   88 VMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK09468  88 EEVDRIVGLEIGADDYLPKPFnprELLARIRAVLRR 123
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
5-116 1.47e-17

transcriptional regulator NarL; Provisional


Pssm-ID: 182619  Cd Length: 216  Bit Score: 80.84  E-value: 1.47e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLE-DSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIV 82
Cdd:PRK10651   6 PATILLIDDHPMLRTGVKQLISmAPDITVVgEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVV 85
                         90       100       110
                 ....*....|....*....|....*....|....
gi 15597994   83 LSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEH 116
Cdd:PRK10651  86 FSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKA 119
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
8-122 5.06e-17

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412  Cd Length: 441  Bit Score: 82.39  E-value: 5.06e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK10365   8 ILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIMTAYS 87
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 15597994   88 VMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:PRK10365  88 SVETAVEALKTGALDYLIKPL-DFDNLQATLEKAL 121
PRK15115 PRK15115
response regulator GlrR; Provisional
1-109 6.47e-17

response regulator GlrR; Provisional


Pssm-ID: 185070  Cd Length: 444  Bit Score: 81.81  E-value: 6.47e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    1 MHKVSATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPI 80
Cdd:PRK15115   1 MSRKPAHLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEALRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPV 80
                         90       100
                 ....*....|....*....|....*....
gi 15597994   81 IVLSGAGVMSDAVEALRLGAADYLIKPLE 109
Cdd:PRK15115  81 IILTAHGSIPDAVAATQQGVFSFLTKPVD 109
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
8-125 7.40e-17

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions]


Pssm-ID: 130454  Cd Length: 218  Bit Score: 79.07  E-value: 7.40e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:TIGR01387   1 ILVVEDEQKTAEYLQQGLSESGYVVDAASNGRDGLHLALKDDYDLIILDVMLPGMDGWQILQTLRRSGKQTPVLFLTARD 80
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 15597994    88 VMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRA 125
Cdd:TIGR01387  81 SVADKVKGLDLGADDYLVKPF-SFSELLARVRTLLRRS 117
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
8-126 1.80e-16

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612  Cd Length: 222  Bit Score: 77.77  E-value: 1.80e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK10643   3 ILIVEDDTLLLQGLILALQTEGYACDCASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLPVLILTARD 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 15597994   88 VMSDAVEALRLGAADYLIKP--LEDLavleHSVRRALDRAY 126
Cdd:PRK10643  83 TLEDRVAGLDVGADDYLVKPfaLEEL----HARIRALIRRH 119
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
6-120 1.90e-16

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522  Cd Length: 225  Bit Score: 77.92  E-value: 1.90e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    6 ATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTaSETPIIVLSG 85
Cdd:PRK10529   2 TNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQW-SAIPVIVLSA 80
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 15597994   86 AGVMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10529  81 RSEESDKIAALDAGADDYLSKPFgigELQARLRVALRR 118
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
8-122 1.94e-16

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 273818  Cd Length: 463  Bit Score: 80.55  E-value: 1.94e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:TIGR01818   1 VWVVDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAHS 80
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 15597994    88 VMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRAL 122
Cdd:TIGR01818  81 DLDTAVAAYQRGAFEYLPKPF-DLDEAVTLVERAL 114
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
8-121 2.87e-16

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387  Cd Length: 219  Bit Score: 77.24  E-value: 2.87e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK10336   3 ILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARD 82
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 15597994   88 VMSDAVEALRLGAADYLIKP---LEDLAVLEHSVRRA 121
Cdd:PRK10336  83 ALAERVEGLRLGADDYLCKPfalIEVAARLEALMRRT 119
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
5-109 1.38e-15

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711  Cd Length: 221  Bit Score: 75.46  E-value: 1.38e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTaSETPIIVLS 84
Cdd:PRK10766   2 SYHILVVEDEPVTRARLQGYFEQEGYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELRSR-STVGIILVT 80
                         90       100
                 ....*....|....*....|....*
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKPLE 109
Cdd:PRK10766  81 GRTDSIDRIVGLEMGADDYVTKPLE 105
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
1-132 1.11e-14

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864  Cd Length: 232  Bit Score: 72.91  E-value: 1.11e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    1 MHKvsatLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESeQPDLVICDLRMPQIDGLELIRRIRQTaSETPI 80
Cdd:PRK10955   1 MNK----ILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDD-SIDLLLLDVMMPKKNGIDTLKELRQT-HQTPV 74
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 15597994   81 IVLSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEHsVRRALDRAYLRVENQ 132
Cdd:PRK10955  75 IMLTARGSELDRVLGLELGADDYLPKPFNDRELVAR-IRAILRRSHWSEQQQ 125
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
8-124 1.30e-14

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102  Cd Length: 227  Bit Score: 72.65  E-value: 1.30e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK09836   3 LLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALG 82
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 15597994   88 VMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDR 124
Cdd:PRK09836  83 TIEHRVKGLELGADDYLVKPFA-FAELLARVRTLLRR 118
pleD PRK09581
response regulator PleD; Reviewed
5-114 5.28e-14

response regulator PleD; Reviewed


Pssm-ID: 236577  Cd Length: 457  Bit Score: 73.01  E-value: 5.28e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASET--PIIV 82
Cdd:PRK09581   2 TARILVVDDIPANVKLLEAKLLAEYYTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATThiPVVM 81
                         90       100       110
                 ....*....|....*....|....*....|..
gi 15597994   83 LSGAGVMSDAVEALRLGAADYLIKPLEDLAVL 114
Cdd:PRK09581  82 VTALDDPEDRVRGLEAGADDFLTKPINDVALF 113
PRK13856 PRK13856
two-component response regulator VirG; Provisional
8-107 1.23e-13

two-component response regulator VirG; Provisional


Pssm-ID: 172377  Cd Length: 241  Bit Score: 69.84  E-value: 1.23e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIrQTASETPIIVLSGAG 87
Cdd:PRK13856   4 VLVIDDDVAMRHLIVEYLTIHAFKVTAVADSQQFNRVLASETVDVVVVDLNLGREDGLEIVRSL-ATKSDVPIIIISGDR 82
                         90       100
                 ....*....|....*....|.
gi 15597994   88 V-MSDAVEALRLGAADYLIKP 107
Cdd:PRK13856  83 LeEADKVVALELGATDFIAKP 103
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
2-120 1.42e-13

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species. [Cellular processes, Sporulation and germination]


Pssm-ID: 131922  Cd Length: 262  Bit Score: 69.82  E-value: 1.42e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     2 HKVSatLLIIDDDEVVRESLAAYL--EDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA-SET 78
Cdd:TIGR02875   1 HKIR--IVIADDNKEFCNLLKEYLaaQPDMEVVGVAHNGVDALELIKEQQPDVVVLDIIMPHLDGIGVLEKLNEIElSAR 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 15597994    79 P-IIVLSGAGVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRR 120
Cdd:TIGR02875  79 PrVIMLSAFGQEKITQRAVALGADYYVLKPF-DLEILAARIRQ 120
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
7-60 3.91e-13

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 64.90  E-value: 3.91e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 15597994      7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMP 60
Cdd:smart00448   2 RILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
8-134 4.52e-13

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376  Cd Length: 221  Bit Score: 67.82  E-value: 4.52e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK15479   3 LLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLQSEMYALAVLDINMPGMDGLEVLQRLRKRGQTLPVLLLTARS 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 15597994   88 VMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRAYLRV-ENQRY 134
Cdd:PRK15479  83 AVADRVKGLNVGADDYLPKPFE-LEELDARLRALLRRSAGQVqEVQQL 129
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
176-350 4.70e-13

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 67.37  E-value: 4.70e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    176 GLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMtTRLLYESRRNgtlpefkPSEVLAHIN 255
Cdd:smart00331   3 GGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSA-LRTLLSEGIS-------LSQILERLN 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    256 RGLINTKLGKH-VTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQAGY-LEGRGLPVGLFDDATYDDRVMELPPSFSLSL 333
Cdd:smart00331  75 RAIYENGEDGMfATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEdLDDLGAPLGLEPDVEVDVRELTLEPGDLLLL 154
                          170
                   ....*....|....*..
gi 15597994    334 FSDGILDVLPGATLKEK 350
Cdd:smart00331 155 YTDGLTEARNPERLEEL 171
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
8-120 5.99e-13

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172  Cd Length: 223  Bit Score: 67.62  E-value: 5.99e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRqTASETPIIVLSGAG 87
Cdd:PRK11517   3 ILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLR-TAKQTPVICLTARD 81
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 15597994   88 VMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK11517  82 SVDDRVRGLDSGANDYLVKPFsfsELLARVRAQLRQ 117
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
10-124 1.71e-12

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842  Cd Length: 469  Bit Score: 68.36  E-value: 1.71e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   10 IIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAGVM 89
Cdd:PRK10923   8 VVDDDSSIRWVLERALAGAGLTCTTFENGNEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDL 87
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 15597994   90 SDAVEALRLGAADYLIKPL---EDLAVLEHSVRRALDR 124
Cdd:PRK10923  88 DAAVSAYQQGAFDYLPKPFdidEAVALVERAISHYQEQ 125
LytT COG3279
DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction ...
9-113 4.51e-12

DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction mechanisms];


Pssm-ID: 225818  Cd Length: 244  Bit Score: 65.07  E-value: 4.51e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   9 LIIDDDEVVRESLA---AYLEDSNFKVlQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSG 85
Cdd:COG3279   5 LIVDDEPLAREELRrilNEIPDIEIVG-EAENGEEALQLLQGLRPDLVFLDIAMPDINGIELAARIRKGDPRPAIVFVTA 83
                        90       100
                ....*....|....*....|....*...
gi 15597994  86 AGVMsdAVEALRLGAADYLIKPLEDLAV 113
Cdd:COG3279  84 HDEY--AVAAFEVEALDYLLKPISEERL 109
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
1-107 2.54e-11

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838  Cd Length: 228  Bit Score: 62.67  E-value: 2.54e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    1 MHKvsATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPI 80
Cdd:PRK11083   1 MQQ--PTILLVEDEQAIADTLVYALQSEGFTVEWFERGLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAFHPALPV 78
                         90       100
                 ....*....|....*....|....*..
gi 15597994   81 IVLSGAGVMSDAVEALRLGAADYLIKP 107
Cdd:PRK11083  79 IFLTARSDEVDRLVGLEIGADDYVAKP 105
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
8-120 3.38e-11

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755  Cd Length: 223  Bit Score: 62.45  E-value: 3.38e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK10816   3 VLVVEDNALLRHHLKVQLQDAGHQVDAAEDAKEADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLTARE 82
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 15597994   88 VMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10816  83 SWQDKVEVLSAGADDYVTKPFhieEVMARMQALMRR 118
PRK11173 PRK11173
two-component response regulator; Provisional
8-107 3.51e-11

two-component response regulator; Provisional


Pssm-ID: 183013  Cd Length: 237  Bit Score: 62.34  E-value: 3.51e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASeTPIIVLSGAG 87
Cdd:PRK11173   6 ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSENDINLVIMDINLPGKNGLLLARELREQAN-VALMFLTGRD 84
                         90       100
                 ....*....|....*....|
gi 15597994   88 VMSDAVEALRLGAADYLIKP 107
Cdd:PRK11173  85 NEVDKILGLEIGADDYITKP 104
CheB COG2201
Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains ...
6-113 5.91e-11

Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains [Cell motility, Signal transduction mechanisms];


Pssm-ID: 225111  Cd Length: 350  Bit Score: 63.08  E-value: 5.91e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   6 ATLLIIDDDEVVRESLAAYLEDSN--FKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASeTPIIVL 83
Cdd:COG2201   2 IRVLVVDDSALMRKVISDILNSDPdiEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDGLEALRKIMRLRP-LPVIMV 80
                        90       100       110
                ....*....|....*....|....*....|..
gi 15597994  84 SGAGV--MSDAVEALRLGAADYLIKPLEDLAV 113
Cdd:COG2201  81 SSLTEegAEATLEALELGAVDFIAKPSGGISL 112
PRK11697 PRK11697
putative two-component response-regulatory protein YehT; Provisional
7-120 7.76e-11

putative two-component response-regulatory protein YehT; Provisional


Pssm-ID: 236956  Cd Length: 238  Bit Score: 61.40  E-value: 7.76e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYL-EDSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRqtaSET-PIIVL 83
Cdd:PRK11697   3 KVLIVDDEPLAREELRELLqEEGDIEIVgECSNAIEAIGAIHRLKPDVVFLDIQMPRISGLELVGMLD---PEHmPYIVF 79
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 15597994   84 SGAgvmSD--AVEALRLGAADYLIKPLEDlAVLEHSVRR 120
Cdd:PRK11697  80 VTA---FDeyAIKAFEEHAFDYLLKPIDP-ARLAKTLAR 114
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
9-112 9.09e-11

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828  Cd Length: 354  Bit Score: 62.47  E-value: 9.09e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    9 LIIDDDEVVRESLAAYLE-DSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQtASETPIIVLS-- 84
Cdd:PRK00742   7 LVVDDSAFMRRLISEILNsDPDIEVVgTAPDGLEAREKIKKLNPDVITLDVEMPVMDGLDALEKIMR-LRPTPVVMVSsl 85
                         90       100       110
                 ....*....|....*....|....*....|.
gi 15597994   85 ---GAGVmsdAVEALRLGAADYLIKPLEDLA 112
Cdd:PRK00742  86 terGAEI---TLRALELGAVDFVTKPFLGIS 113
AmiR COG3707
Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding ...
9-139 1.42e-10

Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226230  Cd Length: 194  Bit Score: 60.04  E-value: 1.42e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   9 LIIDDDEVVRESLAAYLEDSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIrRIRQTASETPIIVL---S 84
Cdd:COG3707   9 LVADDEALTRMDIREGLLEAGYQRVgEAADGLEAVEVCERLQPDVVILDIEMPRRDIIEAL-LLASENVARPIVALtayS 87
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 15597994  85 GAGVMSDAVEAlrlGAADYLIKPLED---LAVLEHSVRRALDRAYLRVENQRYRDKLE 139
Cdd:COG3707  88 DPALIEAAIEA---GVMAYIVKPLDEsrlLPILDVAVSRFEERRALRRELAKLKDRLE 142
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
7-154 1.70e-10

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169  Cd Length: 1197  Bit Score: 62.83  E-value: 1.70e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGA 86
Cdd:PRK09959  960 SILIADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKLREQNSSLPIWGLTAN 1039
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15597994    87 GVMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDRAYLrVENQRYRDkLEAANRELQASLNLLQE 154
Cdd:PRK09959 1040 AQANEREKGLSCGMNLCLFKPLT-LDVLKTHLSQLHQVAHI-APQYRHLD-IEALKNNTANDLQLMQE 1104
marine_sort_RR TIGR03787
proteobacterial dedicated sortase system response regulator; This model describes a family of ...
10-106 2.23e-10

proteobacterial dedicated sortase system response regulator; This model describes a family of DNA-binding response regulator proteins, associated with an adjacent histidine kinase (TIGR03785) to form a two-component system. This system co-occurs with, and often is adjacent to, a proteobacterial variant form of the protein sorting transpeptidase called sortase (TIGR03784), and a single target protein for the sortase. We give this protein the gene symbol pdsR, for Proteobacterial Dedicated Sortase system Response regulator.


Pssm-ID: 163499  Cd Length: 227  Bit Score: 60.15  E-value: 2.23e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    10 IIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRM-PQIDG-LELIRRIRQTASETPIIVLSGAG 87
Cdd:TIGR03787   5 IVEDEAAIRENYADALKRQGYQVTTYADRPSAMQAFRQRLPDLAIIDIGLgEEIDGgFMLCQDLRSLSATLPIIFLTARD 84
                          90
                  ....*....|....*....
gi 15597994    88 VMSDAVEALRLGAADYLIK 106
Cdd:TIGR03787  85 SDFDTVSGLRLGADDYLTK 103
PRK10430 PRK10430
DNA-binding transcriptional activator DcuR; Provisional
9-109 2.32e-10

DNA-binding transcriptional activator DcuR; Provisional


Pssm-ID: 182454  Cd Length: 239  Bit Score: 60.12  E-value: 2.32e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    9 LIIDDDEVVRESLAAYLED-SNFKVLQALNGLQGLQ--IFESEQP-DLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:PRK10430   5 LIVDDDAMVAELNRRYVAQiPGFQCCGTASTLEQAKeiIFNSDTPiDLILLDIYMQQENGLDLLPVLHEAGCKSDVIVIS 84
                         90       100
                 ....*....|....*....|....*
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKPLE 109
Cdd:PRK10430  85 SAADAATIKDSLHYGVVDYLIKPFQ 109
PRK15369 PRK15369
two component system sensor kinase SsrB; Provisional
8-106 2.35e-10

two component system sensor kinase SsrB; Provisional


Pssm-ID: 185267  Cd Length: 211  Bit Score: 59.71  E-value: 2.35e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEV----VRESLAAYledSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIV 82
Cdd:PRK15369   6 ILLVDDHELiingIKNMLAPY---PRYKIVgQVDNGLEVYNACRQLEPDIVILDLGLPGMNGLDVIPQLHQRWPAMNILV 82
                         90       100
                 ....*....|....*....|....
gi 15597994   83 LSGAGVMSDAVEALRLGAADYLIK 106
Cdd:PRK15369  83 LTARQEEHMASRTLAAGALGYVLK 106
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
8-135 3.53e-10

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158). [Regulatory functions, DNA interactions]


Pssm-ID: 274348  Cd Length: 445  Bit Score: 61.30  E-value: 3.53e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     8 LLIIDDDEVVRESLAAYLEDsnFKVLQALNGLQGLQIFESEQPDLVICDLRMP-----QIDGLELIRRIRQTASETPIIV 82
Cdd:TIGR02915   1 LLIVEDDLGLQKQLKWSFAD--YELAVAADRESAIALVRRHEPAVVTLDLGLPpdadgASEGLAALQQILAIAPDTKVIV 78
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 15597994    83 LSGAGVMSDAVEALRLGAADYLIKPLeDLAVLEHSVRRALDRAYLRVENQRYR 135
Cdd:TIGR02915  79 ITGNDDRENAVKAIGLGAYDFYQKPI-DPDVLKLIVDRAFHLYTLETENRRLQ 130
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
8-120 3.79e-10

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277  Cd Length: 229  Bit Score: 59.35  E-value: 3.79e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA--SETPIIVLSG 85
Cdd:PRK10161   5 ILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESmtRDIPVVMLTA 84
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 15597994   86 AGVMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRR 120
Cdd:PRK10161  85 RGEEEDRVRGLETGADDYITKPFspkELVARIKAVMRR 122
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
5-107 6.97e-10

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665  Cd Length: 240  Bit Score: 58.54  E-value: 6.97e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTaSETPIIVLS 84
Cdd:PRK10710  10 TPRILIVEDEPKLGQLLIDYLQAASYATTLLSHGDEVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRF-SDIPIVMVT 88
                         90       100
                 ....*....|....*....|...
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKP 107
Cdd:PRK10710  89 AKIEEIDRLLGLEIGADDYICKP 111
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
8-124 7.04e-10

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 57.29  E-value: 7.04e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNF-KVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA--SETPIIVLS 84
Cdd:PRK10610   8 FLVVDDFSTMRRIVRNLLKELGFnNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGamSALPVLMVT 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKPLEdLAVLEHSVRRALDR 124
Cdd:PRK10610  88 AEAKKENIIAAAQAGASGYVVKPFT-AATLEEKLNKIFEK 126
dpiA PRK10046
two-component response regulator DpiA; Provisional
7-108 2.45e-09

two-component response regulator DpiA; Provisional


Pssm-ID: 182208  Cd Length: 225  Bit Score: 56.95  E-value: 2.45e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLED-SNF-KVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:PRK10046   6 TLLIVEDETPLAEMHAEYIRHiPGFsQILLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTT 85
                         90       100
                 ....*....|....*....|....
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKPL 108
Cdd:PRK10046  86 AASDMETVSEAVRCGVFDYLIKPI 109
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
9-155 2.79e-09

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951  Cd Length: 921  Bit Score: 58.89  E-value: 2.79e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    9 LIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA----SETPIIVLS 84
Cdd:PRK15347 694 LLVDDVETNRDIIGMMLVELGQQVTTAASGTEALELGRQHRFDLVLMDIRMPGLDGLETTQLWRDDPnnldPDCMIVALT 773
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15597994   85 GAGVMSDAVEALRLGAADYLIKP--LEDLA-VLEHSVRRALDRAYLRVENQRYRDKL-----EAANRELQASLNLLQED 155
Cdd:PRK15347 774 ANAAPEEIHRCKKAGMNHYLTKPvtLAQLArALELAAEYQLLRGIELSPQDSSCSPLldtddMALNSKLYQSLLLLLAQ 852
PRK12555 PRK12555
chemotaxis-specific methylesterase; Provisional
9-107 7.87e-09

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 237135  Cd Length: 337  Bit Score: 56.43  E-value: 7.87e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    9 LIIDDDEVVRESLAAYLE-DSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQtASETPIIVLS-- 84
Cdd:PRK12555   4 GIVNDSPLAVEALRRALArDPDHEVVwVATDGAQAVERCAAQPPDVILMDLEMPRMDGVEATRRIMA-ERPCPILIVTsl 82
                         90       100
                 ....*....|....*....|....
gi 15597994   85 -GAGVmSDAVEALRLGAADYLIKP 107
Cdd:PRK12555  83 tERNA-SRVFEAMGAGALDAVDTP 105
PRK10701 PRK10701
DNA-binding transcriptional regulator RstA; Provisional
1-106 1.67e-08

DNA-binding transcriptional regulator RstA; Provisional


Pssm-ID: 236738  Cd Length: 240  Bit Score: 54.64  E-value: 1.67e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    1 MHKVsatlLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASeTPI 80
Cdd:PRK10701   1 MNKI----VFVEDDAEVGSLIAAYLAKHDIDVTVEPRGDRAEATILREQPDLVLLDIMLPGKDGMTICRDLRPKWQ-GPI 75
                         90       100
                 ....*....|....*....|....*.
gi 15597994   81 IVLSGAGVMSDAVEALRLGAADYLIK 106
Cdd:PRK10701  76 VLLTSLDSDMNHILALEMGACDYILK 101
PLN03029 PLN03029
type-a response regulator protein; Provisional
8-168 2.29e-08

type-a response regulator protein; Provisional


Pssm-ID: 215544  Cd Length: 222  Bit Score: 53.88  E-value: 2.29e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIF-----ESEQPD---------------LVICDLRMPQIDGLEL 67
Cdd:PLN03029  11 VLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALKFLglhedDRSNPDtpsvspnshqevevnLIITDYCMPGMTGYDL 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   68 IRRIRQTAS--ETPIIVLSGAGVMSDAVEALRLGAADYLIKP--LEDLAVLEHSVRRALDRAYlRVENQRYRDKLEAANR 143
Cdd:PLN03029  91 LKKIKESSSlrNIPVVIMSSENVPSRITRCLEEGAEEFFLKPvqLSDLNRLKPHMMKTKSKNQ-KQENQEKQEKLEESEI 169
                        170       180
                 ....*....|....*....|....*
gi 15597994  144 ELQASLNLLQEDQNAGRQVQMNMLP 168
Cdd:PLN03029 170 QSEKQEQPSQQPQSQPQPQQQPQQP 194
pleD PRK09581
response regulator PleD; Reviewed
5-151 2.54e-08

response regulator PleD; Reviewed


Pssm-ID: 236577  Cd Length: 457  Bit Score: 55.29  E-value: 2.54e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSnFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIR--QTASETPIIV 82
Cdd:PRK09581 155 DGRILLVDDDVSQAERIANILKEE-FRVVVVSDPSEALFNAAETNYDLVIVSANFENYDPLRLCSQLRskERTRYVPILL 233
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15597994   83 LSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEhsvrraldRAYLRVENQRYRDKLEAanrELQASLNL 151
Cdd:PRK09581 234 LVDEDDDPRLVKALELGVNDYLMRPIDKNELLA--------RVRTQIRRKRYQDALRN---NLEQSIEM 291
SAPR COG3947
Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal ...
8-133 3.38e-08

Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226456  Cd Length: 361  Bit Score: 54.86  E-value: 3.38e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:COG3947   3 IIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFISSHA 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 15597994  88 vmSDAVEALRLGAADYLIKPledlaVLEHSVRRALDRAYLRVENQR 133
Cdd:COG3947  83 --EYADDSFGMNLDDYLPKP-----VTPEKLNRAIDRRLKRVELTA 121
PRK09483 PRK09483
response regulator; Provisional
7-106 5.35e-08

response regulator; Provisional


Pssm-ID: 236538  Cd Length: 217  Bit Score: 52.80  E-value: 5.35e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLED-SNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:PRK09483   3 NVLLVDDHELVRAGIRRILEDiKGIKVVgEACCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRYTPDVKIIMLT 82
                         90       100
                 ....*....|....*....|....*....
gi 15597994   85 -------GAGVMsdavealRLGAADYLIK 106
Cdd:PRK09483  83 vhtenplPAKVM-------QAGAAGYLSK 104
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
30-133 7.64e-08

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229  Cd Length: 435  Bit Score: 53.87  E-value: 7.64e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994  30 FKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRqtASETPIIVLSGAGVMSDAVEALRLGAADYLIKPLE 109
Cdd:COG3706  13 KEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLK--AEPATVVMVTALDDSAPRVRGLKAGADDFLTKPVN 90
                        90       100
                ....*....|....*....|....*....
gi 15597994 110 DLAVLEHSV-----RRALDRAYLRVENQR 133
Cdd:COG3706  91 DSQLFLRAKslvrlKCSIDELRLREETGG 119
PRK13557 PRK13557
histidine kinase; Provisional
5-123 7.85e-08

histidine kinase; Provisional


Pssm-ID: 237425  Cd Length: 540  Bit Score: 53.91  E-value: 7.85e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    5 SATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESE-QPDLVICDLRMP-QIDGLELIRRIRQTASEtpIIV 82
Cdd:PRK13557 415 TETILIVDDRPDVAELARMILEDFGYRTLVASNGREALEILDSHpEVDLLFTDLIMPgGMNGVMLAREARRRQPK--IKV 492
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 15597994   83 LSGAGVMSDAVEALRLGAADYLI--KP--LEDLAvleHSVRRALD 123
Cdd:PRK13557 493 LLTTGYAEASIERTDAGGSEFDIlnKPyrRAELA---RRVRMVLD 534
PRK09958 PRK09958
DNA-binding transcriptional activator EvgA; Provisional
7-84 4.34e-07

DNA-binding transcriptional activator EvgA; Provisional


Pssm-ID: 182168  Cd Length: 204  Bit Score: 49.89  E-value: 4.34e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15597994    7 TLLIIDDDEVVRESLAAYLEDSNFKVLQAL-NGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLS 84
Cdd:PRK09958   2 NAIIIDDHPLAIAAIRNLLIKNDIEILAELtEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVS 80
PRK09935 PRK09935
transcriptional regulator FimZ; Provisional
6-122 1.22e-06

transcriptional regulator FimZ; Provisional


Pssm-ID: 182154  Cd Length: 210  Bit Score: 48.72  E-value: 1.22e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    6 ATLLIIDDDEVVRESLAAYLE-DSNFKV-LQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVL 83
Cdd:PRK09935   4 ASVIIMDTHPIIRMSIEVLLQkNSELQIvLKTDDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFL 83
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 15597994   84 SGAGVMSDAVEALRLGAADYLIKpLEDLAVLEHSVRRAL 122
Cdd:PRK09935  84 SSKSECFYAGRAIQAGANGFVSK-CNDQNDIFHAVQMIL 121
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
8-115 1.32e-06

transcriptional regulator NarP; Provisional


Pssm-ID: 182431  Cd Length: 215  Bit Score: 48.70  E-value: 1.32e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLE-DSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSG 85
Cdd:PRK10403   9 VLIVDDHPLMRRGVRQLLElDPGFEVVaEAGDGASAIDLANRLDPDVILLDLNMKGMSGLDTLNALRRDGVTAQIIILTV 88
                         90       100       110
                 ....*....|....*....|....*....|
gi 15597994   86 AGVMSDAVEALRLGAADYLIKPLEDLAVLE 115
Cdd:PRK10403  89 SDASSDVFALIDAGADGYLLKDSDPEVLLE 118
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
6-108 1.13e-05

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362  Cd Length: 968  Bit Score: 47.47  E-value: 1.13e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994     6 ATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQ---TASETPIIV 82
Cdd:TIGR02956 703 QRVLLVEDNEVNQMVAQGFLTRLGHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQLRAiygAKNEVKFIA 782
                          90       100
                  ....*....|....*....|....*.
gi 15597994    83 LSGAGVMSDAVEALRLGAADYLIKPL 108
Cdd:TIGR02956 783 FSAHVFNEDVAQYLAAGFDGFLAKPV 808
PRK11107 PRK11107
hybrid sensory histidine kinase BarA; Provisional
37-124 1.39e-05

hybrid sensory histidine kinase BarA; Provisional


Pssm-ID: 236848  Cd Length: 919  Bit Score: 47.15  E-value: 1.39e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   37 NGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTA--SETPIIVLSgAGVMSDAVEAL-RLGAADYLIKPLEdlav 113
Cdd:PRK11107 699 SGHQAVEQAKQRPFDLILMDIQMPGMDGIRACELIRQLPhnQNTPIIAVT-AHAMAGERERLlSAGMDDYLAKPID---- 773
                         90
                 ....*....|.
gi 15597994  114 lEHSVRRALDR 124
Cdd:PRK11107 774 -EAMLKQVLLR 783
PRK14084 PRK14084
two-component response regulator; Provisional
9-109 1.48e-05

two-component response regulator; Provisional


Pssm-ID: 184495  Cd Length: 246  Bit Score: 45.90  E-value: 1.48e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    9 LIIDDDEVVRESLAAYL-EDSNFKVL-QALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIrQTASETPIIVLSGA 86
Cdd:PRK14084   4 LIVDDEPLARNELTYLLnEIGGFEEInEAENVKETLEALLINQYDIIFLDINLMDESGIELAAKI-QKMKEPPAIIFATA 82
                         90       100
                 ....*....|....*....|...
gi 15597994   87 GvMSDAVEALRLGAADYLIKPLE 109
Cdd:PRK14084  83 H-DQFAVKAFELNATDYILKPFE 104
PRK10841 PRK10841
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
7-92 2.20e-05

hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional


Pssm-ID: 182772  Cd Length: 924  Bit Score: 46.51  E-value: 2.20e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIvlsga 86
Cdd:PRK10841 803 MILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLTDVNMPNMDGYRLTQRLRQLGLTLPVI----- 877

                 ....*.
gi 15597994   87 GVMSDA 92
Cdd:PRK10841 878 GVTANA 883
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
25-108 2.44e-05

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842  Cd Length: 779  Bit Score: 46.09  E-value: 2.44e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   25 LEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQ---TASETPIIVLSgAGVMSDAVEALRLGAA 101
Cdd:PRK11091 545 LEKLGNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPDMTGLDIARELRErypREDLPPLVALT-ANVLKDKKEYLDAGMD 623

                 ....*..
gi 15597994  102 DYLIKPL 108
Cdd:PRK11091 624 DVLSKPL 630
PRK13558 PRK13558
bacterio-opsin activator; Provisional
8-145 3.35e-05

bacterio-opsin activator; Provisional


Pssm-ID: 237426  Cd Length: 665  Bit Score: 45.60  E-value: 3.35e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    8 LLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESEQPDLVICDLRMPQIDGLELIRRIRQTASETPIIVLSGAG 87
Cdd:PRK13558  10 VLFVGDDPEAGPVDCDLDEDGRLDVTQIRDFVAARDRVEAGEIDCVVADHEPDGFDGLALLEAVRQTTAVPPVVVVPTAG 89
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994   88 VMSDAVEALRLGAADYLIKPLEDL--AVLEHSVRRALDRAYLRVENQRYRDKLEAANREL 145
Cdd:PRK13558  90 DEAVARRAVDADAAAYVPAVSDDAtaAIAERIESAVPEHSRDTEARMPISDLTVESDRRL 149
PRK10360 PRK10360
DNA-binding transcriptional activator UhpA; Provisional
7-106 7.15e-05

DNA-binding transcriptional activator UhpA; Provisional


Pssm-ID: 182408  Cd Length: 196  Bit Score: 43.43  E-value: 7.15e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15597994    7 TLLIIDDDEVVRESLAAYLE-DSNFKVL-------QALNGLQGLQIfeseqpDLVICDLRMPQIDGLELIRRIRQTASet 78
Cdd:PRK10360   3 TVALIDDHLIVRSGFAQLLGlEPDLQVVaefgsgrEALAGLPGRGV------QVCICDISMPDISGLELLSQLPKGMA-- 74
                         90       100
                 ....*....|....*....|....*...
gi 15597994   79 pIIVLSGAGVMSDAVEALRLGAADYLIK 106
Cdd:PRK10360  75 -TIMLSVHDSPALVEQALNAGARGFLSK 101
HisF cd04731
The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol ...
65-102 2.05e-03

The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.


Pssm-ID: 240082  Cd Length: 243  Bit Score: 39.37  E-value: 2.05e-03
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 15597994  65 LELIRRIRQtASETPIIVLSGAGVMSDAVEALRLGAAD 102
Cdd:cd04731 182 LELIRAVSS-AVNIPVIASGGAGKPEHFVEAFEEGGAD 218
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH