NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15229231|ref|NP_187062|]
View 

glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Arabidopsis thaliana]

Protein Classification

aldehyde dehydrogenase (domain architecture ID 11476693)

aldehyde dehydrogenase such as glyceraldehyde-3-phosphate dehydrogenase, which catalyzes the NAD-dependent oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate, and erythrose-4-phosphate dehydrogenase, which catalyzes NAD-dependent conversion of D-erythrose 4-phosphate to 4-phosphoerythronate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PLN02358 PLN02358
glyceraldehyde-3-phosphate dehydrogenase
1-338 0e+00

glyceraldehyde-3-phosphate dehydrogenase


:

Pssm-ID: 165999  Cd Length: 338  Bit Score: 663.73  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTV 80
Cdd:PLN02358   1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKIKDDKTLLFGEKPVTV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   81 FGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
Cdd:PLN02358  81 FGIRNPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:PLN02358 161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
Cdd:PLN02358 241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
                        330
                 ....*....|....*...
gi 15229231  321 EWGYSSRVVDLIVHMSKA 338
Cdd:PLN02358 321 EWGYSSRVVDLIVHMSKA 338
 
Name Accession Description Interval E-value
PLN02358 PLN02358
glyceraldehyde-3-phosphate dehydrogenase
1-338 0e+00

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 165999  Cd Length: 338  Bit Score: 663.73  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTV 80
Cdd:PLN02358   1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKIKDDKTLLFGEKPVTV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   81 FGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
Cdd:PLN02358  81 FGIRNPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:PLN02358 161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
Cdd:PLN02358 241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
                        330
                 ....*....|....*...
gi 15229231  321 EWGYSSRVVDLIVHMSKA 338
Cdd:PLN02358 321 EWGYSSRVVDLIVHMSKA 338
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
5-338 0e+00

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism];


Pssm-ID: 223135  Cd Length: 335  Bit Score: 508.63  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   5 KIRIGINGFGRIGRLVARVVLQRD-DVELVAVNDPfITTEYMTYMFKYDSVHGQWKHNElkIKDEKTLLFGEKPVTVFGI 83
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDgDIEVVAINDL-TDPDYLAHLLKYDSVHGRFDGEV--EVKDDALVVNGKGIKVLAE 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  84 RNPEDIPWAEAGADYVVESTGVFTDKDKAAAHL-KGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASCTTNCL 161
Cdd:COG0057  78 RDPANLPWADLGVDIVVECTGKFTGREKAEKHLkAGGAKKVLISAPGKDDvATVVYGVNHNYYDAGHTIVSNASCTTNCL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231 162 APLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSmKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPT 241
Cdd:COG0057 158 APVAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPH-KDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPT 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231 242 VDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNE 321
Cdd:COG0057 237 PNVSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNE 316
                       330
                ....*....|....*..
gi 15229231 322 WGYSSRVVDLIVHMSKA 338
Cdd:COG0057 317 WGYSNRVVDLLAMVAKA 333
GAPDH-I TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
7-330 1.70e-171

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675  Cd Length: 326  Bit Score: 483.70  E-value: 1.70e-171
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231     7 RIGINGFGRIGRLVARVVLQRDD--VELVAVNDPfITTEYMTYMFKYDSVHGQWKHnELKIkDEKTLLFGEKPVT-VFGI 83
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPGndLEVVAINDL-TDLEKLAYLLKYDSVHGRFEG-EVTV-DEDGLVVNGKEVIsVFSE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    84 RNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASCTTNCLA 162
Cdd:TIGR01534  78 RDPSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDvKTIVYGVNHDEYDGEERIISNASCTTNCLA 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   163 PLAKVINDRFGIVEGLMTTVHSITATQKTVDGPsMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 242
Cdd:TIGR01534 158 PLAKVLDEAFGIVSGLMTTVHAYTNDQNLLDGP-HKDLRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTP 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   243 DVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIA--LSDKFVKLVSWYDN 320
Cdd:TIGR01534 237 NVSLVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVtgLGDSLVKVYAWYDN 316
                         330
                  ....*....|
gi 15229231   321 EWGYSSRVVD 330
Cdd:TIGR01534 317 EWGYSNRLVD 326
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
161-318 9.13e-91

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 308445  Cd Length: 158  Bit Score: 271.78  E-value: 9.13e-91
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:pfam02800   1 LAPLAKVLNDAFGIKKGLMTTVHAYTNDQKLLDGPHHKDLRRGRAAAPNIIPTSTGAAKAVGLVLPELKGKLDGMAVRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15229231   241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWY 318
Cdd:pfam02800  81 TPNVSVVDLVVELEKPVTVEEVNAALKEAAEGALKGILGYTEDPLVSSDFVGDPHSSIFDAKETIVVGGNFVKVVAWY 158
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
6-156 5.10e-72

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 223.58  E-value: 5.10e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231      6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDPfITTEYMTYMFKYDSVHGQWKHnELKIKDEkTLLFGEKPVTVFGIRN 85
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPDVEVVAINDL-TDPEYLAYLLKYDSVHGRFPG-TVEVEGD-GLVVNGKAIKVFAERD 77
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15229231     86 PEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASC 156
Cdd:smart00846  78 PANLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDAdPTFVYGVNHDEYDGEDHIISNASC 149
 
Name Accession Description Interval E-value
PLN02358 PLN02358
glyceraldehyde-3-phosphate dehydrogenase
1-338 0e+00

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 165999  Cd Length: 338  Bit Score: 663.73  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTV 80
Cdd:PLN02358   1 MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKIKDDKTLLFGEKPVTV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   81 FGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
Cdd:PLN02358  81 FGIRNPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:PLN02358 161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
Cdd:PLN02358 241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
                        330
                 ....*....|....*...
gi 15229231  321 EWGYSSRVVDLIVHMSKA 338
Cdd:PLN02358 321 EWGYSSRVVDLIVHMSKA 338
PLN02272 PLN02272
glyceraldehyde-3-phosphate dehydrogenase
2-336 0e+00

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 177912  Cd Length: 421  Bit Score: 623.03  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    2 ADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKhNELKIKDEKTLLFGEKPVTVF 81
Cdd:PLN02272  82 SSGKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNFK-GTINVVDDSTLEINGKQIKVT 160
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   82 GIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCL 161
Cdd:PLN02272 161 SKRDPAEIPWGDFGAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCL 240
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  162 APLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPT 241
Cdd:PLN02272 241 APLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPT 320
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  242 VDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNE 321
Cdd:PLN02272 321 PNVSVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNE 400
                        330
                 ....*....|....*
gi 15229231  322 WGYSSRVVDLIVHMS 336
Cdd:PLN02272 401 WGYSNRVLDLIEHMA 415
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
5-338 0e+00

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism];


Pssm-ID: 223135  Cd Length: 335  Bit Score: 508.63  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   5 KIRIGINGFGRIGRLVARVVLQRD-DVELVAVNDPfITTEYMTYMFKYDSVHGQWKHNElkIKDEKTLLFGEKPVTVFGI 83
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDgDIEVVAINDL-TDPDYLAHLLKYDSVHGRFDGEV--EVKDDALVVNGKGIKVLAE 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  84 RNPEDIPWAEAGADYVVESTGVFTDKDKAAAHL-KGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASCTTNCL 161
Cdd:COG0057  78 RDPANLPWADLGVDIVVECTGKFTGREKAEKHLkAGGAKKVLISAPGKDDvATVVYGVNHNYYDAGHTIVSNASCTTNCL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231 162 APLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSmKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPT 241
Cdd:COG0057 158 APVAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPH-KDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPT 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231 242 VDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNE 321
Cdd:COG0057 237 PNVSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNE 316
                       330
                ....*....|....*..
gi 15229231 322 WGYSSRVVDLIVHMSKA 338
Cdd:COG0057 317 WGYSNRVVDLLAMVAKA 333
PTZ00023 PTZ00023
glyceraldehyde-3-phosphate dehydrogenase; Provisional
6-337 2.17e-175

glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173322  Cd Length: 337  Bit Score: 494.35  E-value: 2.17e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHnELKIKDEKtLLFGEKPVTVFGIRN 85
Cdd:PTZ00023   3 VKLGINGFGRIGRLVFRAALEREDVEVVAINDPFMTLDYMCYLLKYDSVHGSLPA-EVSVTDGF-LMIGSKKVHVFFEKD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   86 PEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKD-APMFVVGVNEHEYKSDLDIVSNASCTTNCLAPL 164
Cdd:PTZ00023  81 PAAIPWGKNGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPPKDdTPIYVMGVNHTQYDKSQRIVSNASCTTNCLAPL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  165 AKVINDRFGIVEGLMTTVHSITATQKTVDGPSM--KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 242
Cdd:PTZ00023 161 AKVVNDKFGIVEGLMTTVHASTANQLTVDGPSKggKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  243 DVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEW 322
Cdd:PTZ00023 241 DVSVVDLTCKLAKPAKYEEIVAAVKKAAEGPLKGILGYTDDEVVSSDFVHDKRSSIFDVKAGIALNDTFVKLVSWYDNEW 320
                        330
                 ....*....|....*
gi 15229231  323 GYSSRVVDLIVHMSK 337
Cdd:PTZ00023 321 GYSNRLLDLAHYITQ 335
GAPDH-I TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
7-330 1.70e-171

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675  Cd Length: 326  Bit Score: 483.70  E-value: 1.70e-171
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231     7 RIGINGFGRIGRLVARVVLQRDD--VELVAVNDPfITTEYMTYMFKYDSVHGQWKHnELKIkDEKTLLFGEKPVT-VFGI 83
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPGndLEVVAINDL-TDLEKLAYLLKYDSVHGRFEG-EVTV-DEDGLVVNGKEVIsVFSE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    84 RNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASCTTNCLA 162
Cdd:TIGR01534  78 RDPSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDvKTIVYGVNHDEYDGEERIISNASCTTNCLA 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   163 PLAKVINDRFGIVEGLMTTVHSITATQKTVDGPsMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 242
Cdd:TIGR01534 158 PLAKVLDEAFGIVSGLMTTVHAYTNDQNLLDGP-HKDLRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTP 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   243 DVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIA--LSDKFVKLVSWYDN 320
Cdd:TIGR01534 237 NVSLVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVtgLGDSLVKVYAWYDN 316
                         330
                  ....*....|
gi 15229231   321 EWGYSSRVVD 330
Cdd:TIGR01534 317 EWGYSNRLVD 326
gapA PRK15425
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
6-337 4.20e-149

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 185323  Cd Length: 331  Bit Score: 427.23  E-value: 4.20e-149
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDpFITTEYMTYMFKYDSVHGQWKhNELKIKDEKTLLFGEKpVTVFGIRN 85
Cdd:PRK15425   3 IKVGINGFGRIGRIVFRAAQKRSDIEIVAIND-LLDADYMAYMLKYDSTHGRFD-GTVEVKDGHLIVNGKK-IRVTAERD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   86 PEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKD-APMFVVGVNEHEYKSDlDIVSNASCTTNCLAPL 164
Cdd:PRK15425  80 PANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDnTPMFVKGANFDKYAGQ-DIVSNASCTTNCLAPL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  165 AKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDV 244
Cdd:PRK15425 159 AKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNV 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  245 SVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGY 324
Cdd:PRK15425 239 SVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGY 318
                        330
                 ....*....|...
gi 15229231  325 SSRVVDLIVHMSK 337
Cdd:PRK15425 319 SNKVLDLIAHISK 331
PTZ00434 PTZ00434
cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional
6-336 3.10e-145

cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional


Pssm-ID: 185614  Cd Length: 361  Bit Score: 418.69  E-value: 3.10e-145
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQRD----DVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIK-------DEKTLLFG 74
Cdd:PTZ00434   4 IKVGINGFGRIGRMVFQAICDQGligtEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKsspsvktDDVLVVNG 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   75 EKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAP-SKDAPMFVVGVNEHEYK-SDLDIVS 152
Cdd:PTZ00434  84 HRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPaSGGAKTIVMGVNQHEYSpTEHHVVS 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  153 NASCTTNCLAPLAKVI-NDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGK 231
Cdd:PTZ00434 164 NASCTTNCLAPIVHVLtKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTKGK 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  232 LTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKA----GIAL 307
Cdd:PTZ00434 244 LTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNRSSIYDSKAtlqnNLPG 323
                        330       340
                 ....*....|....*....|....*....
gi 15229231  308 SDKFVKLVSWYDNEWGYSSRVVDLIVHMS 336
Cdd:PTZ00434 324 ERRFFKIVSWYDNEWGYSHRVVDLVRYMA 352
PRK07729 PRK07729
glyceraldehyde-3-phosphate dehydrogenase; Validated
5-337 7.03e-128

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 236079  Cd Length: 343  Bit Score: 373.69  E-value: 7.03e-128
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFiTTEYMTYMFKYDSVHGQWKhNELKIKDEKTLLFGEKpVTVFGIR 84
Cdd:PRK07729   2 KTKVAINGFGRIGRMVFRKAIKESAFEIVAINASY-PSETLAHLIKYDTVHGKFD-GTVEAFEDHLLVDGKK-IRLLNNR 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   85 NPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPM-FVVGVNEHEYKSDLD-IVSNASCTTNCLA 162
Cdd:PRK07729  79 DPKELPWTDLGIDIVIEATGKFNSKEKAILHVEAGAKKVILTAPGKNEDVtIVVGVNEDQLDIEKHtIISNASCTTNCLA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  163 PLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSmKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 242
Cdd:PRK07729 159 PVVKVLDEQFGIENGLMTTVHAYTNDQKNIDNPH-KDLRRARACGQSIIPTTTGAAKALAKVLPHLNGKLHGMALRVPTP 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  243 DVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEW 322
Cdd:PRK07729 238 NVSLVDLVVDVKRDVTVEEINEAFKTAANGALKGILEFSEEPLVSIDFNTNTHSAIIDGLSTMVMGDRKVKVLAWYDNEW 317
                        330
                 ....*....|....*
gi 15229231  323 GYSSRVVDLIVHMSK 337
Cdd:PRK07729 318 GYSCRVVDLVTLVAD 332
PRK07403 PRK07403
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
6-331 7.76e-118

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 180962  Cd Length: 337  Bit Score: 347.66  E-value: 7.76e-118
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQRDD--VELVAVNDpfiTTEYMT--YMFKYDSVHGqwKHNELKIKDEKTLLFGEKPVTVF 81
Cdd:PRK07403   2 IRVAINGFGRIGRNFLRCWLGRENsqLELVAIND---TSDPRTnaHLLKYDSMLG--KLNADISADENSITVNGKTIKCV 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   82 GIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSK--DAPMFVVGVNEHEYKSDL-DIVSNASCTT 158
Cdd:PRK07403  77 SDRNPLNLPWKEWGIDLIIESTGVFVTKEGASKHIQAGAKKVLITAPGKgeDIGTYVVGVNHHEYDHEDhNIISNASCTT 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  159 NCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFR 238
Cdd:PRK07403 157 NCLAPIAKVLHDNFGIIKGTMTTTHSYTGDQRILDA-SHRDLRRARAAAVNIVPTSTGAAKAVALVIPELKGKLNGIALR 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  239 VPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWY 318
Cdd:PRK07403 236 VPTPNVSVVDLVVQVEKRTITEQVNEVLKDASEGPLKGILEYSDLPLVSSDYRGTDASSIVDASLTMVMGGDMVKVIAWY 315
                        330
                 ....*....|...
gi 15229231  319 DNEWGYSSRVVDL 331
Cdd:PRK07403 316 DNEWGYSQRVVDL 328
PLN03096 PLN03096
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
1-331 8.06e-109

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 215572  Cd Length: 395  Bit Score: 326.89  E-value: 8.06e-109
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    1 MADKKIRIGINGFGRIGRLVARVVLQRDD--VELVAVNDPFiTTEYMTYMFKYDSVHGQWKhNELKIKDEKTLLFGEKPV 78
Cdd:PLN03096  56 VTEAKIKVAINGFGRIGRNFLRCWHGRKDspLDVVAINDTG-GVKQASHLLKYDSTLGTFD-ADVKPVGDDAISVDGKVI 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   79 TVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSK-DAPMFVVGVNEHEYKSDLDIVSNASCT 157
Cdd:PLN03096 134 KVVSDRNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKgDIPTYVVGVNADDYKHSDPIISNASCT 213
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  158 TNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSF 237
Cdd:PLN03096 214 TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIAL 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  238 RVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSW 317
Cdd:PLN03096 293 RVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKELKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAW 372
                        330
                 ....*....|....
gi 15229231  318 YDNEWGYSSRVVDL 331
Cdd:PLN03096 373 YDNEWGYSQRVVDL 386
PLN02237 PLN02237
glyceraldehyde-3-phosphate dehydrogenase B
1-331 6.01e-108

glyceraldehyde-3-phosphate dehydrogenase B


Pssm-ID: 215131  Cd Length: 442  Bit Score: 326.09  E-value: 6.01e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    1 MADKKIRIGINGFGRIGRLVARVVLQRDD--VELVAVNDPFiTTEYMTYMFKYDSVHGQWKhNELKIKDEKTLLFGEKPV 78
Cdd:PLN02237  71 ETVAKLKVAINGFGRIGRNFLRCWHGRKDspLDVVVVNDSG-GVKNASHLLKYDSMLGTFK-ADVKIVDDETISVDGKPI 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   79 TVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSK--DAPMFVVGVNEHEYKSDL-DIVSNAS 155
Cdd:PLN02237 149 KVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKgaDIPTYVVGVNEDDYDHEVaNIVSNAS 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  156 CTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM 235
Cdd:PLN02237 229 CTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGI 307
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  236 SFRVPTVDVSVVDLTVRLEKAA-TYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKL 314
Cdd:PLN02237 308 ALRVPTPNVSVVDLVVNVEKKGiTAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKV 387
                        330
                 ....*....|....*..
gi 15229231  315 VSWYDNEWGYSSRVVDL 331
Cdd:PLN02237 388 VAWYDNEWGYSQRVVDL 404
PRK08955 PRK08955
glyceraldehyde-3-phosphate dehydrogenase; Validated
5-332 1.11e-102

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 169599  Cd Length: 334  Bit Score: 308.97  E-value: 1.11e-102
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNelKIKDEKTLLFGEKPVTVFGIR 84
Cdd:PRK08955   2 TIKVGINGFGRIGRLALRAAWDWPEVEFVQINDPAGDAATLAHLLEFDSVHGRWHHE--VTAEGDAIVINGKRIRTTQNK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   85 NPEDIPWAeaGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMF--VVGVNEHEYKSDLD-IVSNASCTTNCL 161
Cdd:PRK08955  80 AIADTDWS--GCDVVIEASGVMKTKALLQAYLDQGVKRVVVTAPVKEEGVLniVMGVNDHLFDPAIHpIVTAASCTTNCL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  162 APLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSmKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPT 241
Cdd:PRK08955 158 APVVKVIHEKLGIKHGSMTTIHDLTNTQTILDAPH-KDLRRARACGMSLIPTTTGSATAITEIFPELKGKLNGHAVRVPL 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  242 VDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNE 321
Cdd:PRK08955 237 ANASLTDCVFEVERDTTVEEVNALLKEAAEGELKGILGYEERPLVSIDYKTDPRSSIVDALSTMVVNGTQVKLYAWYDNE 316
                        330
                 ....*....|.
gi 15229231  322 WGYSSRVVDLI 332
Cdd:PRK08955 317 WGYANRTAELA 327
PRK13535 PRK13535
erythrose 4-phosphate dehydrogenase; Provisional
6-338 1.24e-92

erythrose 4-phosphate dehydrogenase; Provisional


Pssm-ID: 184122  Cd Length: 336  Bit Score: 283.10  E-value: 1.24e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQ---RDDVELVAVNDpFITTEYMTYMFKYDSVHGQWKHnelKIKDEKTLLF-GEKPVTVF 81
Cdd:PRK13535   2 IRVAINGFGRIGRNVLRALYEsgrRAEITVVAINE-LADAEGMAHLLKYDTSHGRFAW---DVRQERDQLFvGDDAIRLL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   82 GIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSK---DAPMfVVGVNEHEYKSDLDIVSNASCTT 158
Cdd:PRK13535  78 HERDIASLPWRELGVDVVLDCTGVYGSREDGEAHIAAGAKKVLFSHPGSndlDATV-VYGVNHDQLRAEHRIVSNASCTT 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  159 NCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFR 238
Cdd:PRK13535 157 NCIIPVIKLLDDAFGIESGTVTTIHSAMNDQQVIDA-YHPDLRRTRAASQSIIPVDTKLAAGITRIFPQFNDRFEAISVR 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  239 VPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWY 318
Cdd:PRK13535 236 VPTINVTAIDLSVTVKKPVKVNEVNQLLQKAAQGAFHGIVDYTELPLVSIDFNHDPHSAIVDGTQTRVSGAHLIKTLVWC 315
                        330       340
                 ....*....|....*....|
gi 15229231  319 DNEWGYSSRVVDLIVHMSKA 338
Cdd:PRK13535 316 DNEWGFANRMLDTTLAMAAA 335
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
161-318 9.13e-91

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 308445  Cd Length: 158  Bit Score: 271.78  E-value: 9.13e-91
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:pfam02800   1 LAPLAKVLNDAFGIKKGLMTTVHAYTNDQKLLDGPHHKDLRRGRAAAPNIIPTSTGAAKAVGLVLPELKGKLDGMAVRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 15229231   241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWY 318
Cdd:pfam02800  81 TPNVSVVDLVVELEKPVTVEEVNAALKEAAEGALKGILGYTEDPLVSSDFVGDPHSSIFDAKETIVVGGNFVKVVAWY 158
E4PD_g-proteo TIGR01532
erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases ...
7-330 9.73e-86

erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases in gamma-proteobacteria which utilize NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose. This enzyme activity appears to have evolved from glyceraldehyde-3-phosphate dehydrogenase, whose substrate differs only in the lack of one carbon relative to E4P. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]


Pssm-ID: 130595  Cd Length: 325  Bit Score: 265.22  E-value: 9.73e-86
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231     7 RIGINGFGRIGRLVARVVLQ---RDDVELVAVNDpFITTEYMTYMFKYDSVHGQWKHnelKIKDEKTLLF-GEKPVTVFG 82
Cdd:TIGR01532   1 RVAINGFGRIGRNVLRALYEsgrRAEITVVAINE-LADAAGMAHLLKYDTSHGRFAW---EVRQDRDQLFvGDDAIRVLH 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    83 IRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAP-SKDAPMFVV-GVNEHEYKSDLDIVSNASCTTNC 160
Cdd:TIGR01532  77 ERSLQSLPWRELGVDLVLDCTGVYGSREHGEAHIAAGAKKVLFSHPgASDLDATIVyGVNQDQLRAEHRIVSNASCTTNC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   161 LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVP 240
Cdd:TIGR01532 157 IVPVIKLLDDAYGIESGTITTIHSAMNDQQVIDA-YHPDLRRTRAASQSIIPVDTKLAAGIERFFPQFNDRFEAIAVRVP 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   241 TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDN 320
Cdd:TIGR01532 236 TVNVTAIDLSVTVKKPVKANEVNLLLQKAAQGALRGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLVKTLVWCDN 315
                         330
                  ....*....|
gi 15229231   321 EWGYSSRVVD 330
Cdd:TIGR01532 316 EWGFANRMLD 325
PRK08289 PRK08289
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
12-338 1.38e-83

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 236219  Cd Length: 477  Bit Score: 264.48  E-value: 1.38e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   12 GFGRIGRLVARVVLQR----DDVELVAV-------NDpfitTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTV 80
Cdd:PRK08289 134 GFGRIGRLLARLLIEKtgggNGLRLRAIvvrkgseGD----LEKRASLLRRDSVHGPFNGTITVDEENNAIIANGNYIQV 209
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   81 FGIRNPEDIPWAEAGAD--YVVESTGVFTDKDKAAAHLKG-GAKKVVISAPSK-DAPMFVVGVNEHEYKSDLDIVSNASC 156
Cdd:PRK08289 210 IYANSPEEVDYTAYGINnaLVVDNTGKWRDEEGLSQHLKSkGVAKVLLTAPGKgDIKNIVHGVNHSDITDEDKIVSAASC 289
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  157 TTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDwRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMS 236
Cdd:PRK08289 290 TTNAITPVLKAVNDKYGIVNGHVETVHSYTNDQNLIDNYHKGD-RRGRSAPLNMVITETGAAKAVAKALPELAGKLTGNA 368
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  237 FRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES-EGKLKGILGYTED-DVVSTDFVGDNRSSIFDAKAGIAlSDKFVKL 314
Cdd:PRK08289 369 IRVPTPNVSMAILNLNLEKETSREELNEYLRQMSlHSPLQNQIDYTDStEVVSSDFVGSRHAGVVDSQATIV-NGNRAVL 447
                        330       340
                 ....*....|....*....|....
gi 15229231  315 VSWYDNEWGYSSRVVDLIVHMSKA 338
Cdd:PRK08289 448 YVWYDNEFGYSCQVVRVMEQMAGV 471
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
6-156 5.10e-72

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 223.58  E-value: 5.10e-72
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231      6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDPfITTEYMTYMFKYDSVHGQWKHnELKIKDEkTLLFGEKPVTVFGIRN 85
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPDVEVVAINDL-TDPEYLAYLLKYDSVHGRFPG-TVEVEGD-GLVVNGKAIKVFAERD 77
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15229231     86 PEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDA-PMFVVGVNEHEYKSDLDIVSNASC 156
Cdd:smart00846  78 PANLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDAdPTFVYGVNHDEYDGEDHIISNASC 149
PTZ00353 PTZ00353
glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional
6-338 1.19e-59

glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173546  Cd Length: 342  Bit Score: 198.18  E-value: 1.19e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRN 85
Cdd:PTZ00353   3 ITVGINGFGPVGKAVLFASLTDPLVTVVAVNDASVSIAYIAYVLEQESPLSAPDGASIRVVGEQIVLNGTQKIRVSAKHD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   86 PEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLA 165
Cdd:PTZ00353  83 LVEIAWRDYGVQYVVECTGLYSTRSRCWGHVTGGAKGVFVAGQSADAPTVMAGSNDERLSASLPVCCAGAPIAVALAPVI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  166 KVINDRFGIVEGLMTTVHSITAtQKTVDGPSM--KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVD 243
Cdd:PTZ00353 163 RALHEVYGVEECSYTAIHGMQP-QEPIAARSKnsQDWRQTRVAIDAIAPYRDNGAETVCKLLPHLVGRISGSAFQVPVKK 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  244 VSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRsSIFDAKAGIALSD-KFVKLVSWYDNEW 322
Cdd:PTZ00353 242 GCAIDMLVRTKQPVSKEVVDSALAEAASDRLNGVLCISKRDMISVDCIPNGK-LCYDATSSSSSREgEVHKMVLWFDVEC 320
                        330
                 ....*....|....*.
gi 15229231  323 GYSSRVVDLIVHMSKA 338
Cdd:PTZ00353 321 YYAARLLSLVKQLHQI 336
Gp_dh_N pfam00044
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
6-109 1.18e-42

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 306541  Cd Length: 101  Bit Score: 145.70  E-value: 1.18e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231     6 IRIGINGFGRIGRLVARVVLQRDDVELVAVNDpFITTEYMTYMFKYDSVHGQWKHnELKIkDEKTLLFGEKPVTVFGIRN 85
Cdd:pfam00044   1 VKVGINGFGRIGRLVLRAALERPDIEVVAIND-LTDPETLAHLLKYDSVHGRFPG-EVEA-DEDGLIVNGKKIKVFAERD 77
                          90       100
                  ....*....|....*....|....
gi 15229231    86 PEDIPWAEAGADYVVESTGVFTDK 109
Cdd:pfam00044  78 PAELPWGDLGVDVVIESTGVFTTK 101
Asd COG0136
Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism];
73-273 3.86e-08

Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism];


Pssm-ID: 223214  Cd Length: 334  Bit Score: 54.16  E-value: 3.86e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  73 FGEKPVTVfgirnPEDIP--WAEAGADYVVESTGvftdKDKAAAHLKGGAK--KVVISAPS-----KDAPMFVVGVNEH- 142
Cdd:COG0136  47 FGGKSIGV-----PEDAAdeFVFSDVDIVFFAAG----GSVSKEVEPKAAEagCVVIDNSSafrmdPDVPLVVPEVNPEh 117
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231 143 --EYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSI----------TATQKTVDGPSMKDWRGGRAASFNI 210
Cdd:COG0136 118 liDYQKRGFIIANPNCSTIQLVLALKPLHDAFGIKRVVVSTYQAVsgagaeggveLAGQTDALLNGIPILPIGYPLAFNV 197
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15229231 211 IP-----SSTGAAKA-------VGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGK 273
Cdd:COG0136 198 IPhidgfLDNGYTKEewkieaeTRKILGDPDIKVSATCVRVPVFYGHSEAVTVEFKKDVDPEEIREELLPSAPGV 272
DapB_N pfam01113
Dihydrodipicolinate reductase, N-terminus; Dihydrodipicolinate reductase (DapB) reduces the ...
6-35 6.75e-05

Dihydrodipicolinate reductase, N-terminus; Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.


Pssm-ID: 307319  Cd Length: 121  Bit Score: 41.84  E-value: 6.75e-05
                          10        20        30
                  ....*....|....*....|....*....|.
gi 15229231     6 IRIGINGF-GRIGRLVARVVLQRDDVELVAV 35
Cdd:pfam01113   1 IKVAVVGAsGRMGRELIKAILEAPDLELVAA 31
PRK04207 PRK04207
glyceraldehyde-3-phosphate dehydrogenase; Provisional
5-35 4.03e-04

glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 179786  Cd Length: 341  Bit Score: 41.35  E-value: 4.03e-04
                         10        20        30
                 ....*....|....*....|....*....|.
gi 15229231    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAV 35
Cdd:PRK04207   1 MIKVGVNGYGTIGKRVADAVAAQPDMELVGV 31
PRK00048 PRK00048
dihydrodipicolinate reductase; Provisional
5-35 6.02e-04

dihydrodipicolinate reductase; Provisional


Pssm-ID: 234595  Cd Length: 257  Bit Score: 40.51  E-value: 6.02e-04
                         10        20        30
                 ....*....|....*....|....*....|..
gi 15229231    5 KIRIGINGF-GRIGRLVARVVLQRDDVELVAV 35
Cdd:PRK00048   1 MIKVAVAGAsGRMGRELIEAVEAAEDLELVAA 32
DapB COG0289
Dihydrodipicolinate reductase [Amino acid transport and metabolism];
5-35 8.97e-04

Dihydrodipicolinate reductase [Amino acid transport and metabolism];


Pssm-ID: 223366  Cd Length: 266  Bit Score: 40.33  E-value: 8.97e-04
                        10        20        30
                ....*....|....*....|....*....|..
gi 15229231   5 KIRIGINGF-GRIGRLVARVVLQRDDVELVAV 35
Cdd:COG0289   2 MIKVAVAGAsGRMGRTLIRAVLEAPDLELVAA 33
PRK08664 PRK08664
aspartate-semialdehyde dehydrogenase; Reviewed
86-268 2.09e-03

aspartate-semialdehyde dehydrogenase; Reviewed


Pssm-ID: 236329  Cd Length: 349  Bit Score: 39.42  E-value: 2.09e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   86 PEDIPwaEAGADYVVESTG---------VFT--DKDKAA----AHLKGGakKVVISAPS-----KDAPMFVVGVN-EH-- 142
Cdd:PRK08664  54 DGPIP--EEVADMEVVSTDpeavddvdiVFSalPSDVAGeveeEFAKAG--KPVFSNASahrmdPDVPLVIPEVNpEHle 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231  143 --EYKSDLD-----IVSNASCTTNCLAPLAKVInDRFGIVEGLMTTVHSITATQKT-VDGPSMKDwrggraasfNIIPSS 214
Cdd:PRK08664 130 liEVQRKRRgwdgfIVTNPNCSTIGLVLALKPL-MDFGIERVHVTTMQAISGAGYPgVPSMDIVD---------NVIPYI 199
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 15229231  215 TG-AAKAV------------GKVLPAlNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKE 268
Cdd:PRK08664 200 GGeEEKIEketlkilgkfegGKIVPA-DFPISATCHRVPVIDGHTEAVFVKFKEDVDPEEIREALES 265
asd_EA TIGR00978
aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms); Two closely related ...
150-275 2.22e-03

aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms); Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. Separate models are built for the two types in order to exclude the USG-1 protein, found in several species, which is specifically related to the Bacillus subtilis type of aspartate-semialdehyde dehydrogenase. Members of this type are found primarily in organisms that lack peptidoglycan. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273376  Cd Length: 341  Bit Score: 39.35  E-value: 2.22e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   150 IVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSIT-ATQKTVdgPSMkdwrggrAASFNIIPSSTGAAKAVGKVLPAL 228
Cdd:TIGR00978 140 IVTNPNCTTAGLTLALKPLIDAFGIKKVHVTTMQAVSgAGYPGV--PSM-------DILDNIIPHIGGEEEKIERETRKI 210
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 15229231   229 NGKLTG------------MSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLK 275
Cdd:TIGR00978 211 LGKLENgkiepapfsvsaTTTRVPVLDGHTESVHVEFDKKFDIEEIREALKSFRGLPQK 269
GAPDH-II_archae TIGR01546
glyceraldehyde-3-phosphate dehydrogenase, type II; This model describes the type II ...
8-268 3.29e-03

glyceraldehyde-3-phosphate dehydrogenase, type II; This model describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea. These enzymes catalyze the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. In archaea, either NAD or NADP may be utilized as the cofactor. The class I GAPDH's from bacteria and eukaryotes are covered by TIGR01534. All of the members of the seed are characterized. See, for instance. This model is very solid, there are no species falling between trusted and noise at this time. The closest relatives scoring in the noise are the class I GAPDH's.


Pssm-ID: 130609  Cd Length: 333  Bit Score: 38.70  E-value: 3.29e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231     8 IGINGFGRIGRLVARVVLQRDDVELVAVNDpfITTEYMTYMFKydsvhgqwkhnelkikdektllfgEKPVTVFgIRNPE 87
Cdd:TIGR01546   1 VGVNGYGTIGKRVADAVTKQDDMKLVGVTK--TSPDFEAYRAK------------------------ELGIPVY-AASEE 53
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    88 DIP-WAEAG-------------ADYVVEST--GV------FTDKDKAAAHLKGGAKKVVISAPskdapmFVVGVNeheYK 145
Cdd:TIGR01546  54 FIPrFEEAGievagtledllekVDIVVDATpgGIgaknkpLYEKAGVKAIFQGGEKAEVADVS------FVAQAN---YE 124
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   146 SDL--DIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGP--SMKdwrggraASFNIIPSSTGaaKAV 221
Cdd:TIGR01546 125 AALgkDYVRVVSCNTTGLVRTLNAINDYSKVDKVRAVMVRRAADPNDVKKGPinAIV-------PDPVTVPSHHG--PDV 195
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 15229231   222 GKVLPALNgkLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKE 268
Cdd:TIGR01546 196 QTVIPNLN--IETMAFVVPTTLMHVHSIMVELKKPVTKDDIIDILEN 240
asd_B TIGR01296
aspartate-semialdehyde dehydrogenase (peptidoglycan organisms); Two closely related families ...
69-307 3.58e-03

aspartate-semialdehyde dehydrogenase (peptidoglycan organisms); Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. This model represents a branch more closely related to the USG-1 protein than to the other aspartate-semialdehyde dehydrogenases represented in model TIGR00978. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273543  Cd Length: 338  Bit Score: 38.64  E-value: 3.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231    69 KTLLFGEKPVTVFGIrNPEDIpwaeAGADYVVESTGVFTDKDKAAAHLKGGAkkVVISAPS-----KDAPMFVVGVNEHE 143
Cdd:TIGR01296  40 RKLTFKGKELEVEEA-ETESF----EGIDIALFSAGGSVSKEFAPKAAKAGV--IVIDNTSafrmdPDVPLVVPEVNFED 112
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   144 YK--SDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITA------------TQKTVDGPSMKDWRGGRAA--- 206
Cdd:TIGR01296 113 LKefNPKGIIANPNCSTIQMVVVLKPLHDEAKIKRVVVSTYQAVSGagnagveelynqTKAVLEGAEQLPYIQPKANkfp 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15229231   207 ---SFNIIP------------SSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESE 271
Cdd:TIGR01296 193 yqiAFNAIPhidsfvddgytkEEQKMLFETRKIMGIPDLKVSATCVRVPVFTGHSESINIEFEKEISPEDARELLKNAPG 272
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|..
gi 15229231   272 GKL----KGILGYTEDDVVSTD--FVGDNRSSIFDAKaGIAL 307
Cdd:TIGR01296 273 VQLiddpSGNLYPTPLAAVGVDevFVGRIRKDLPDGN-GLHL 313
myo_inos_iolG TIGR04380
inositol 2-dehydrogenase; All members of the seed alignment for this model are known or ...
5-39 7.66e-03

inositol 2-dehydrogenase; All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]


Pssm-ID: 275173  Cd Length: 330  Bit Score: 37.58  E-value: 7.66e-03
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 15229231     5 KIRIGINGFGRIGRLVARVVLQR-DDVELVAVNDPF 39
Cdd:TIGR04380   1 KLKVGIIGAGRIGKVHAENLATHvPGARLKAIVDPF 36
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH