NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148379791|ref|YP_001254332|]
View 

sporulation domain protein [Clostridium botulinum A str. ATCC 3502]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc super family cl00120
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
31-216 4.39e-12

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


The actual alignment was detected with superfamily member pfam07228:

Pssm-ID: 320769  Cd Length: 190  Bit Score: 64.58  E-value: 4.39e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   31 DCTIIVLADGLGSGVKANILSTLTSKIAATMLKEGANLYDTVDTIvNTLPICKIRNIAYSTFTLIKI-YNNGDAYIAEYD 109
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRL-NRLLQRNLEEDMFATAVLAVYdPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  110 SPPIFIIRNNEyldfpKKEMIIDSKRVL----------ESNIKLRPGDLLTVVSDGVIhaglgEILNLGWQWENVKDYLE 179
Cdd:pfam07228  81 HPPPLLLRPDG-----GVVELLESTGLPlgilpdadyeVVELELEPGDTLLLYTDGLT-----EARDPDGELFGLERLLA 150
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 148379791  180 R-RSHQNMSAQFIAKDLLEVCFDLYSGKPGDDTTVVSV 216
Cdd:pfam07228 151 LlAERHGLPPEELLDALLEALLRLGGGELEDDITLLVL 188
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
31-216 4.39e-12

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 64.58  E-value: 4.39e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   31 DCTIIVLADGLGSGVKANILSTLTSKIAATMLKEGANLYDTVDTIvNTLPICKIRNIAYSTFTLIKI-YNNGDAYIAEYD 109
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRL-NRLLQRNLEEDMFATAVLAVYdPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  110 SPPIFIIRNNEyldfpKKEMIIDSKRVL----------ESNIKLRPGDLLTVVSDGVIhaglgEILNLGWQWENVKDYLE 179
Cdd:pfam07228  81 HPPPLLLRPDG-----GVVELLESTGLPlgilpdadyeVVELELEPGDTLLLYTDGLT-----EARDPDGELFGLERLLA 150
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 148379791  180 R-RSHQNMSAQFIAKDLLEVCFDLYSGKPGDDTTVVSV 216
Cdd:pfam07228 151 LlAERHGLPPEELLDALLEALLRLGGGELEDDITLLVL 188
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
14-219 2.10e-10

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs. [Cellular processes, Sporulation and germination]


Pssm-ID: 274328  Cd Length: 764  Bit Score: 62.40  E-value: 2.10e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   14 KYGEELCGDMVEVVRLSDCT-IIVLADGLGSGVKANILSTLTSKIAATMLKEGANLYDTVDTiVNTLPICKIRNIAYSTF 92
Cdd:TIGR02865 561 KDGELVSGDSYSFGKLSAGKyAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKT-VNSILSLRSTDEKFSTL 639
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   93 TL--IKIYNnGDAYIAEYDSPPIFIIRNNEYLDFPKKEM---IIDSKRVLESNIKLRPGDLLTVVSDGVIHAGLGEILNL 167
Cdd:TIGR02865 640 DLsvIDLYT-GQAEFVKVGAVPSFIKRGAKVEVIRSSNLpigILDEVDVELVRKKLKNGDLIVMVSDGVLEGEKEVEGKV 718
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 148379791  168 GWqwenVKDYLERRshQNMSAQFIAKDLLEVCFDLYSGKPGDDTTVVSVGIK 219
Cdd:TIGR02865 719 LW----LVRKLKET--NTNDPEEIAEYLLEKAKELRSGKIKDDMTVIVAKVY 764
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
13-197 1.88e-09

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 56.59  E-value: 1.88e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791    13 NKYGEELCGDMVEVVRLSDCTI-IVLADGLGSGVKANilstLTSKIAATMLKEGANLYDTVDTIVNTLpickIRNIA--- 88
Cdd:smart00331  10 YEDATQVGGDFYDVVKLPEGRLlIAIADVMGKGLAAA----LAMSMARSALRTLLSEGISLSQILERL----NRAIYeng 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791    89 ----YSTFTLIKI-YNNGDAYIAEYDSPPIFIIRNNEYLDFPKKE-----MIIDSKRVLESNIKLRPGDLLTVVSDGVIh 158
Cdd:smart00331  82 edgmFATLFLALYdFAGGTLSYANAGHSPPYLLRADGGLVEDLDDlgaplGLEPDVEVDVRELTLEPGDLLLLYTDGLT- 160
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 148379791   159 aglgEILNLGWqwenvkDYLERRSHQNMSAQFIAKDLLE 197
Cdd:smart00331 161 ----EARNPER------LEELLEELLGSPPAEIAQRILE 189
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
17-220 8.74e-03

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 37.77  E-value: 8.74e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  17 EELCGDMVEVVRLSDCTI-IVLADGLGSGVKANILS----TLTSKIAATMLKEGANLYDTVDTIV-NTLPICKIRNIAYS 90
Cdd:COG2208  159 SEVGGDYYDFIQLGEKRLrIGIGDVSGKGVPAALLMlmpkLALRLLLESGPLDPADVLETLNRVLkQNLEEDMFVTLFLG 238
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  91 TFTLIKiyNNGDAYIAEydSPPIFIIRNNEYLDFPKKEM------IIDSKRVLESNIKLRPGDLLTVVSDGVIHAG--LG 162
Cdd:COG2208  239 VYDLDS--GELTYSNAG--HEPALILSADGEIEVEDLTAlglpigLLPDYQYEVASLQLEPGDLLVLYTDGVTEARnsDG 314
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791 163 EILNLgwqwENVKDYLERRSHQnmSAQFIAKDLLE-VC-FDLYSGKPgDDTTVVSVGIKR 220
Cdd:COG2208  315 EFFGL----ERLLKILGRLLGQ--PAEEILEAILEsLEeLQGDQIQD-DDITLLVLKVKK 367
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
31-216 4.39e-12

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 64.58  E-value: 4.39e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   31 DCTIIVLADGLGSGVKANILSTLTSKIAATMLKEGANLYDTVDTIvNTLPICKIRNIAYSTFTLIKI-YNNGDAYIAEYD 109
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRL-NRLLQRNLEEDMFATAVLAVYdPETGTLEYANAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  110 SPPIFIIRNNEyldfpKKEMIIDSKRVL----------ESNIKLRPGDLLTVVSDGVIhaglgEILNLGWQWENVKDYLE 179
Cdd:pfam07228  81 HPPPLLLRPDG-----GVVELLESTGLPlgilpdadyeVVELELEPGDTLLLYTDGLT-----EARDPDGELFGLERLLA 150
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 148379791  180 R-RSHQNMSAQFIAKDLLEVCFDLYSGKPGDDTTVVSV 216
Cdd:pfam07228 151 LlAERHGLPPEELLDALLEALLRLGGGELEDDITLLVL 188
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
14-219 2.10e-10

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs. [Cellular processes, Sporulation and germination]


Pssm-ID: 274328  Cd Length: 764  Bit Score: 62.40  E-value: 2.10e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   14 KYGEELCGDMVEVVRLSDCT-IIVLADGLGSGVKANILSTLTSKIAATMLKEGANLYDTVDTiVNTLPICKIRNIAYSTF 92
Cdd:TIGR02865 561 KDGELVSGDSYSFGKLSAGKyAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKT-VNSILSLRSTDEKFSTL 639
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791   93 TL--IKIYNnGDAYIAEYDSPPIFIIRNNEYLDFPKKEM---IIDSKRVLESNIKLRPGDLLTVVSDGVIHAGLGEILNL 167
Cdd:TIGR02865 640 DLsvIDLYT-GQAEFVKVGAVPSFIKRGAKVEVIRSSNLpigILDEVDVELVRKKLKNGDLIVMVSDGVLEGEKEVEGKV 718
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 148379791  168 GWqwenVKDYLERRshQNMSAQFIAKDLLEVCFDLYSGKPGDDTTVVSVGIK 219
Cdd:TIGR02865 719 LW----LVRKLKET--NTNDPEEIAEYLLEKAKELRSGKIKDDMTVIVAKVY 764
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
13-197 1.88e-09

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 56.59  E-value: 1.88e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791    13 NKYGEELCGDMVEVVRLSDCTI-IVLADGLGSGVKANilstLTSKIAATMLKEGANLYDTVDTIVNTLpickIRNIA--- 88
Cdd:smart00331  10 YEDATQVGGDFYDVVKLPEGRLlIAIADVMGKGLAAA----LAMSMARSALRTLLSEGISLSQILERL----NRAIYeng 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791    89 ----YSTFTLIKI-YNNGDAYIAEYDSPPIFIIRNNEYLDFPKKE-----MIIDSKRVLESNIKLRPGDLLTVVSDGVIh 158
Cdd:smart00331  82 edgmFATLFLALYdFAGGTLSYANAGHSPPYLLRADGGLVEDLDDlgaplGLEPDVEVDVRELTLEPGDLLLLYTDGLT- 160
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 148379791   159 aglgEILNLGWqwenvkDYLERRSHQNMSAQFIAKDLLE 197
Cdd:smart00331 161 ----EARNPER------LEELLEELLGSPPAEIAQRILE 189
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
17-220 8.74e-03

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 37.77  E-value: 8.74e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  17 EELCGDMVEVVRLSDCTI-IVLADGLGSGVKANILS----TLTSKIAATMLKEGANLYDTVDTIV-NTLPICKIRNIAYS 90
Cdd:COG2208  159 SEVGGDYYDFIQLGEKRLrIGIGDVSGKGVPAALLMlmpkLALRLLLESGPLDPADVLETLNRVLkQNLEEDMFVTLFLG 238
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791  91 TFTLIKiyNNGDAYIAEydSPPIFIIRNNEYLDFPKKEM------IIDSKRVLESNIKLRPGDLLTVVSDGVIHAG--LG 162
Cdd:COG2208  239 VYDLDS--GELTYSNAG--HEPALILSADGEIEVEDLTAlglpigLLPDYQYEVASLQLEPGDLLVLYTDGVTEARnsDG 314
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 148379791 163 EILNLgwqwENVKDYLERRSHQnmSAQFIAKDLLE-VC-FDLYSGKPgDDTTVVSVGIKR 220
Cdd:COG2208  315 EFFGL----ERLLKILGRLLGQ--PAEEILEAILEsLEeLQGDQIQD-DDITLLVLKVKK 367
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH