NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148237996|ref|NP_001088436|]
View 

programmed cell death 5 S homeolog [Xenopus laevis]

Protein Classification

similar to DNA-binding protein DDB_G0278111 (domain architecture ID 10487993)

protein similar to DNA-binding protein DDB_G0278111

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-114 2.69e-36

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


:

Pssm-ID: 307898  Cd Length: 105  Bit Score: 122.58  E-value: 2.69e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996    9 IRRQRMSELQSKHGDAGNDQsQQEAKQREDDMRNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMARFGQLGGKL 88
Cdd:pfam01984   1 IRRARLAELQQQQGGGQGGE-QEQAQEEEEEQKRAILRQILTPEARERLNRIALVKPERAEAVENQLIQLAQSGQLRGKI 79
                          90       100
                  ....*....|....*....|....*.
gi 148237996   89 SEDGLIEILEKVSQQTEKKITVKFNR 114
Cdd:pfam01984  80 TEEQLKELLEQVSEQKKKETKIKFER 105
 
Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-114 2.69e-36

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


Pssm-ID: 307898  Cd Length: 105  Bit Score: 122.58  E-value: 2.69e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996    9 IRRQRMSELQSKHGDAGNDQsQQEAKQREDDMRNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMARFGQLGGKL 88
Cdd:pfam01984   1 IRRARLAELQQQQGGGQGGE-QEQAQEEEEEQKRAILRQILTPEARERLNRIALVKPERAEAVENQLIQLAQSGQLRGKI 79
                          90       100
                  ....*....|....*....|....*.
gi 148237996   89 SEDGLIEILEKVSQQTEKKITVKFNR 114
Cdd:pfam01984  80 TEEQLKELLEQVSEQKKKETKIKFER 105
PDCD5 COG2118
DNA-binding TFAR19-related protein, PDSD5 family [General function prediction only];
1-115 2.49e-24

DNA-binding TFAR19-related protein, PDSD5 family [General function prediction only];


Pssm-ID: 225029  Cd Length: 116  Bit Score: 92.04  E-value: 2.49e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996   1 MADPELEAIRRQRMSELQSKHGDAGNDQSQQE-AKQREDDMRNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMA 79
Cdd:COG2118    1 MDDEELEEIRRRKLAELQRQAKLEEQREAQEEqARQEEEAQKQAILRQILTPEARERLARVRLVRPELAEAVENQLIQLA 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 148237996  80 RFGQLGGKLSEDGLIEILEKVSQQTEKKITVKFNRR 115
Cdd:COG2118   81 QTGRITHKIDEEELKEILERISPQTRREFKIRRRRK 116
PRK04239 PRK04239
hypothetical protein; Provisional
4-111 9.04e-19

hypothetical protein; Provisional


Pssm-ID: 179798  Cd Length: 110  Bit Score: 77.23  E-value: 9.04e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996   4 PELEAIRRQRMSELQSKHGDAGNDQSQQEAKQREDDM-RNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMARFG 82
Cdd:PRK04239   1 EELEEIRRRKLEELQKQAQEQQQAQEEQEEAQAQAEAqKQAILRQILTPEARERLNRIKLVKPEFAEQVEQQLIQLAQSG 80
                         90       100       110
                 ....*....|....*....|....*....|
gi 148237996  83 QLGGKLSEDGLIEILEKV-SQQTEKKITVK 111
Cdd:PRK04239  81 RIQGPIDDEQLKEILEQLtPQKREFKITRR 110
 
Name Accession Description Interval E-value
dsDNA_bind pfam01984
Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 ...
9-114 2.69e-36

Double-stranded DNA-binding domain; This domain is believed to bind double-stranded DNA of 20 bases length.


Pssm-ID: 307898  Cd Length: 105  Bit Score: 122.58  E-value: 2.69e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996    9 IRRQRMSELQSKHGDAGNDQsQQEAKQREDDMRNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMARFGQLGGKL 88
Cdd:pfam01984   1 IRRARLAELQQQQGGGQGGE-QEQAQEEEEEQKRAILRQILTPEARERLNRIALVKPERAEAVENQLIQLAQSGQLRGKI 79
                          90       100
                  ....*....|....*....|....*.
gi 148237996   89 SEDGLIEILEKVSQQTEKKITVKFNR 114
Cdd:pfam01984  80 TEEQLKELLEQVSEQKKKETKIKFER 105
PDCD5 COG2118
DNA-binding TFAR19-related protein, PDSD5 family [General function prediction only];
1-115 2.49e-24

DNA-binding TFAR19-related protein, PDSD5 family [General function prediction only];


Pssm-ID: 225029  Cd Length: 116  Bit Score: 92.04  E-value: 2.49e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996   1 MADPELEAIRRQRMSELQSKHGDAGNDQSQQE-AKQREDDMRNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMA 79
Cdd:COG2118    1 MDDEELEEIRRRKLAELQRQAKLEEQREAQEEqARQEEEAQKQAILRQILTPEARERLARVRLVRPELAEAVENQLIQLA 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 148237996  80 RFGQLGGKLSEDGLIEILEKVSQQTEKKITVKFNRR 115
Cdd:COG2118   81 QTGRITHKIDEEELKEILERISPQTRREFKIRRRRK 116
PRK04239 PRK04239
hypothetical protein; Provisional
4-111 9.04e-19

hypothetical protein; Provisional


Pssm-ID: 179798  Cd Length: 110  Bit Score: 77.23  E-value: 9.04e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148237996   4 PELEAIRRQRMSELQSKHGDAGNDQSQQEAKQREDDM-RNNILAQVLSQAARARLNNLALVKPEKAKAVENYLIQMARFG 82
Cdd:PRK04239   1 EELEEIRRRKLEELQKQAQEQQQAQEEQEEAQAQAEAqKQAILRQILTPEARERLNRIKLVKPEFAEQVEQQLIQLAQSG 80
                         90       100       110
                 ....*....|....*....|....*....|
gi 148237996  83 QLGGKLSEDGLIEILEKV-SQQTEKKITVK 111
Cdd:PRK04239  81 RIQGPIDDEQLKEILEQLtPQKREFKITRR 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH