NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148230949|ref|NP_001091200|]
View 

fatty acid amide hydrolase, gene 1 S homeolog [Xenopus laevis]

Protein Classification

amidase (domain architecture ID 10477466)

amidase catalyzes the hydrolysis of a monocarboxylic acid amide to form a monocarboxylate and ammonia

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Amidase pfam01425
Amidase;
97-567 8.95e-115

Amidase;


:

Pssm-ID: 279733  Cd Length: 447  Bit Score: 351.60  E-value: 8.95e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   97 VLVAYIEKALEVNKELNC-LTDFLSECEAQLQEVKKQ----KEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQED 171
Cdd:pfam01425   2 LVEAFLDRIEAANPKLNAfVTVFPDEALAQAAALDKQraagDPKGPLHGVPIAVKDNIDVKGVPTTAGSKALENYPAPYD 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  172 SVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCS 251
Cdd:pfam01425  82 ATVVERLRKAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGGVPLAIGTDTGGSIRIPAS 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  252 FCGICGLKPSGNRLSSLGfstpVSGMKSAVMMPGPMARDVDSLALFMKAVLCDDMFQLDPTVPPVP-FRDEIYNSSKPLT 330
Cdd:pfam01425 162 FCGLVGLKPTYGRVSRYG----VVPYASSLDQVGPLARSVEDAALLLRVISGYDPKDSTSLPSPPPdFAEPLKKSLKGLR 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  331 IGFYDTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGfFADGGSTLVDKFNADIVDPNLKqqml 410
Cdd:pfam01425 238 IGVYREDGYDDLDPEVQRAVEKAAAALEALGHEVVEVDPPSLDHALPLYYLIA-PAEASSNLARYDGVRYRLSGPD---- 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  411 lYKIPTIVKKIITFFMRPVFPRIANHVNAHCGVGSVKQLWKHNAAIKEYRCEYINEWKKlnLDALLCP-MLGPAFNIGCP 489
Cdd:pfam01425 313 -DLSELYPRTRAEGLGDEVKRRIILGNYALSAGYSGAYYLKAQKVRRLIRREFAGAFEE--LDVLLSPtAPTPAPRLGEP 389
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949  490 GKLFAgfcFTMLFNILNFPAGVLPVNIVTPEDeeelknykgyyndlwdkDVIKGMEDGVGLPLAVQCVALPWQEEQCL 567
Cdd:pfam01425 390 DKADS---PTVMYNLLDFTAGVVPVNLAGLPA-----------------ISVPAGFSPDGLPVGVQIIGKPFDEETLL 447
 
Name Accession Description Interval E-value
Amidase pfam01425
Amidase;
97-567 8.95e-115

Amidase;


Pssm-ID: 279733  Cd Length: 447  Bit Score: 351.60  E-value: 8.95e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   97 VLVAYIEKALEVNKELNC-LTDFLSECEAQLQEVKKQ----KEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQED 171
Cdd:pfam01425   2 LVEAFLDRIEAANPKLNAfVTVFPDEALAQAAALDKQraagDPKGPLHGVPIAVKDNIDVKGVPTTAGSKALENYPAPYD 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  172 SVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCS 251
Cdd:pfam01425  82 ATVVERLRKAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGGVPLAIGTDTGGSIRIPAS 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  252 FCGICGLKPSGNRLSSLGfstpVSGMKSAVMMPGPMARDVDSLALFMKAVLCDDMFQLDPTVPPVP-FRDEIYNSSKPLT 330
Cdd:pfam01425 162 FCGLVGLKPTYGRVSRYG----VVPYASSLDQVGPLARSVEDAALLLRVISGYDPKDSTSLPSPPPdFAEPLKKSLKGLR 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  331 IGFYDTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGfFADGGSTLVDKFNADIVDPNLKqqml 410
Cdd:pfam01425 238 IGVYREDGYDDLDPEVQRAVEKAAAALEALGHEVVEVDPPSLDHALPLYYLIA-PAEASSNLARYDGVRYRLSGPD---- 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  411 lYKIPTIVKKIITFFMRPVFPRIANHVNAHCGVGSVKQLWKHNAAIKEYRCEYINEWKKlnLDALLCP-MLGPAFNIGCP 489
Cdd:pfam01425 313 -DLSELYPRTRAEGLGDEVKRRIILGNYALSAGYSGAYYLKAQKVRRLIRREFAGAFEE--LDVLLSPtAPTPAPRLGEP 389
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949  490 GKLFAgfcFTMLFNILNFPAGVLPVNIVTPEDeeelknykgyyndlwdkDVIKGMEDGVGLPLAVQCVALPWQEEQCL 567
Cdd:pfam01425 390 DKADS---PTVMYNLLDFTAGVVPVNLAGLPA-----------------ISVPAGFSPDGLPVGVQIIGKPFDEETLL 447
GatA COG0154
Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase [Translation, ribosomal ...
74-580 6.24e-63

Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223232  Cd Length: 475  Bit Score: 216.01  E-value: 6.24e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  74 HIVSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSECEAQLQEVK-------KQKEKGLLYGVPITLK 146
Cdd:COG0154    3 ALTELTAAELAALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAaadarlaAGEPLGPLAGVPIAVK 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 147 DNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEA 226
Cdd:COG0154   83 DNIDTAGLPTTAGSKALEDYVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVPGGSSGGSA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 227 ALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAvmmpGPMARDVDSLALFMKAVLCDDM 306
Cdd:COG0154  163 AAVAAGLVPLALGSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGVVPLASSLDQI----GPLARTVRDAALLLDVIAGPDP 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 307 fQLDPTVPPVPFRDE-IYNSSKPLTIGFY-DTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGF 384
Cdd:COG0154  239 -RDSPLPPPPPVPPAlAGKDLKGLRIGVPkELGGGGPLDPDVRAAFEAAVKALEAAGAEVVEVSLPLLSDDYALAAYYLA 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 385 FADG------GSTLVDKFNADIVDPNlkqqmllykiptiVKKIItffmrpvfpRIANHVNAHcgvgsvkqLWKHNAAIKE 458
Cdd:COG0154  318 RFDGeryglrAADLYGKTRAEGFGPE-------------VKRRI---------MLGTYLLSA--------GYYDAYYRRA 367
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 459 YRCEYINEWKKL--NLDALLCPMLG-PAFNIGCPGKLFAG--FC-----FTMLFNILNFPAGVLPVNivtpedeeelkny 528
Cdd:COG0154  368 QKTLIRRAFDKLfeEVDVLLTPTTPtPAPKIGESESDGDDplEMylldvFTVPANLAGLPAISVPAG------------- 434
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148230949 529 kgyyndlwdkdvikgmEDGVGLPLAVQCVALPWQEEQCLRLMKEVENVTRGK 580
Cdd:COG0154  435 ----------------FTADGLPVGLQLIGPAFDDATLLRLAAALEQALGWH 470
gatA PRK00012
aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed
87-376 4.55e-41

aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed


Pssm-ID: 234572  Cd Length: 459  Bit Score: 154.12  E-value: 4.55e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  87 LKKGSLAAESVLVAYIEKALEVNKELNCltdFLSECEAQ-LQEVKK------QKEKGLLYGVPITLKDNVGYKGHDSHCG 159
Cdd:PRK00012   1 LKNKEISAVELTQAYLDRIEEVDPKLNA---FITVTEEEaLAQAKAadaklaAGEAGPLAGIPIAIKDNICTKGIRTTCA 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 160 ---LVQFLGIADqedSVIVQVLKKHGAVPFVKTNipqsMINF----DCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGG 232
Cdd:PRK00012  78 skiLENYVPPYD---ATVVEKLKAAGAVILGKTN----MDEFamgsSTENSAFGPTKNPWDLERVPGGSSGGSAAAVAAG 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 233 GAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLG---FStpvSGMKSAvmmpGPMARDVDSLALfmkavLCDDMFQL 309
Cdd:PRK00012 151 LAPAALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGliaFA---SSLDQI----GPFARTVEDAAL-----LLNAIAGH 218
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949 310 DP----TVP-PVP-FRDEIYNSSKPLTIGF---YDTDGYflpSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYAL 376
Cdd:PRK00012 219 DPkdstSADvPVPdYTAALGKDIKGLKIGVpkeYFGEGL---DPEVKEAVEAAIKKLEDLGAEIVEVSLPHTKYAL 291
gatA TIGR00132
aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase ...
83-376 2.33e-39

aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase is missing. tRNA(Gln) is misacylated with Glu after which a heterotrimeric amidotransferase converts Glu to Gln. This model represents the amidase chain of that heterotrimer, encoded by the gatA gene. In the Archaea, Asn--tRNA ligase is also missing. This amidase subunit may also function in the conversion of Asp-tRNA(Asn) to Asn-tRNA(Asn), presumably with a different recognition unit to replace gatB. Both Methanococcus jannaschii and Methanobacterium thermoautotrophicum have both authentic gatB and a gatB-related gene, but only one gene like gatA. It has been shown that gatA can be expressed only when gatC is also expressed. In most species expressing the amidotransferase, the gatC ortholog is about 90 residues in length, but in Mycoplasma genitalium and Mycoplasma pneumoniae the gatC equivalent is as the C-terminal domain of a much longer protein. Not surprisingly, the Mycoplasmas also represent the most atypical lineage of gatA orthology. This orthology group is more narrowly defined here than in Proc Natl Acad Aci USA 94, 11819-11826 (1997). In particular, a Rhodococcus homolog found in association with nitrile hydratase genes and described as an enantiomer-selective amidase active on several 2-aryl propionamides, is excluded here. It is likely, however, that the amidase subunit GatA is not exclusively a part of the Glu-tRNA(Gln) amidotransferase heterotrimer and restricted to that function in all species. [Protein synthesis, tRNA aminoacylation]


Pssm-ID: 272925  Cd Length: 460  Bit Score: 149.03  E-value: 2.33e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   83 LVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSEcEAQLQEVK-KQKEKGLLYGVPITLKDNVGYKGHDSHCG-- 159
Cdd:TIGR00132   1 LRQLLKKKEISIKEVLEASLDRIEANKDKINAFLEVTVE-KALKQAKKlDKAILTPLAGIPIAVKDNISTKGIVTTCAsk 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  160 -LVQFLGIADqedSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGV 238
Cdd:TIGR00132  80 iLENYIPPYD---ATVIERLKQAGALIIGKTNMDEFAMGSSTETSAFGPTKNPWNLDRVPGGSSGGSAAAVAADLAPFSL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  239 GTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAvmmpGPMARDVDSLALFMKAVLCDDMfqLDPT---VPP 315
Cdd:TIGR00132 157 GSDTGGSIRQPASFCGVVGFKPTYGRVSRYGLVAYASSLDQI----GPFARTVEDIALLLDVISGHDK--RDSTsakVPD 230
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949  316 VPFRDEIYNSSKPLTIG-----FYDTDgyflpsPGMRRAIQETKALLEEAGHKLVPFSPPRIEYAL 376
Cdd:TIGR00132 231 PEFFEELKKDLKGLKVGvvkefSEEMD------KEVQEKFENALEVLEELGAEIVEVSFPHVKYAL 290
PRK07488 PRK07488
indole acetimide hydrolase; Validated
75-380 3.43e-34

indole acetimide hydrolase; Validated


Pssm-ID: 236030 [Multi-domain]  Cd Length: 472  Bit Score: 133.94  E-value: 3.43e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  75 IVSLTLSQLVDQLKKGSLAAESVLVAYIEKAlEVNKELNCLTDFlsECEAQLQEVKK---QKEKG---LLYGVPITLKDN 148
Cdd:PRK07488   8 VASLSLTEAAAALRSGRLSCLELVEALLARA-AALAPLNAFTTV--DAEGALAAARRidaQRAAGaalLLAGVPIVIKDN 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 149 VGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAAL 228
Cdd:PRK07488  85 INTAGMPTTAGTPALLGFVPATDAPVVQRLLDAGAVPLGKANMHELAFGITSNNGAFGAVRNPYDPARIAGGSSGGTAAA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 229 IAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSGMKSAVmmpGPMARDVDSLALfMKAVLCDDmfq 308
Cdd:PRK07488 165 VAARLAPAGLGTDTGGSVRIPAALCGVVGLRPTVGRYSGDGV-VPISHTRDTV---GPIARSVADLAL-LDAVITGD--- 236
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148230949 309 lDPTVPPVPFRdeiynsskPLTIGFYDTdGYFLP-SPGMRRAIQETKALLEEAGHKLVPFSPPRIEyALNELC 380
Cdd:PRK07488 237 -AALPAPVALA--------GLRLGVPAA-PFWDGlDPDVAAVAEAALAKLAAAGVTFVELDLPGLH-ELNEAV 298
allophanate_hyd TIGR02713
allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent ...
124-269 1.04e-15

allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent two-step degradation of urea to ammonia and C02, following the action of the biotin-containing urea carboxylase. The yeast enzyme, a fusion of allophanate hydrolase to urea carboxylase, is designated urea amidolyase. [Central intermediary metabolism, Nitrogen metabolism]


Pssm-ID: 274265 [Multi-domain]  Cd Length: 561  Bit Score: 78.92  E-value: 1.04e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  124 AQLQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADqEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNS 203
Cdd:TIGR02713  18 AALDARDARPERLPLYGVPFAVKDNIDVAGLPTTAACPAFAYTPE-EDATVVALLRAAGAIVVGKTNLDQFATGLVGTRS 96
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949  204 IFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLG 269
Cdd:TIGR02713  97 PYGAVRNAFDPAYISGGSSSGSAVAVARGLVPFALGTDTAGSGRVPAALNNIVGLKPTKGLVSTTG 162
 
Name Accession Description Interval E-value
Amidase pfam01425
Amidase;
97-567 8.95e-115

Amidase;


Pssm-ID: 279733  Cd Length: 447  Bit Score: 351.60  E-value: 8.95e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   97 VLVAYIEKALEVNKELNC-LTDFLSECEAQLQEVKKQ----KEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQED 171
Cdd:pfam01425   2 LVEAFLDRIEAANPKLNAfVTVFPDEALAQAAALDKQraagDPKGPLHGVPIAVKDNIDVKGVPTTAGSKALENYPAPYD 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  172 SVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCS 251
Cdd:pfam01425  82 ATVVERLRKAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWDLSRTPGGSSGGSAAAVAAGGVPLAIGTDTGGSIRIPAS 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  252 FCGICGLKPSGNRLSSLGfstpVSGMKSAVMMPGPMARDVDSLALFMKAVLCDDMFQLDPTVPPVP-FRDEIYNSSKPLT 330
Cdd:pfam01425 162 FCGLVGLKPTYGRVSRYG----VVPYASSLDQVGPLARSVEDAALLLRVISGYDPKDSTSLPSPPPdFAEPLKKSLKGLR 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  331 IGFYDTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGfFADGGSTLVDKFNADIVDPNLKqqml 410
Cdd:pfam01425 238 IGVYREDGYDDLDPEVQRAVEKAAAALEALGHEVVEVDPPSLDHALPLYYLIA-PAEASSNLARYDGVRYRLSGPD---- 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  411 lYKIPTIVKKIITFFMRPVFPRIANHVNAHCGVGSVKQLWKHNAAIKEYRCEYINEWKKlnLDALLCP-MLGPAFNIGCP 489
Cdd:pfam01425 313 -DLSELYPRTRAEGLGDEVKRRIILGNYALSAGYSGAYYLKAQKVRRLIRREFAGAFEE--LDVLLSPtAPTPAPRLGEP 389
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949  490 GKLFAgfcFTMLFNILNFPAGVLPVNIVTPEDeeelknykgyyndlwdkDVIKGMEDGVGLPLAVQCVALPWQEEQCL 567
Cdd:pfam01425 390 DKADS---PTVMYNLLDFTAGVVPVNLAGLPA-----------------ISVPAGFSPDGLPVGVQIIGKPFDEETLL 447
GatA COG0154
Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase [Translation, ribosomal ...
74-580 6.24e-63

Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223232  Cd Length: 475  Bit Score: 216.01  E-value: 6.24e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  74 HIVSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSECEAQLQEVK-------KQKEKGLLYGVPITLK 146
Cdd:COG0154    3 ALTELTAAELAALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAaadarlaAGEPLGPLAGVPIAVK 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 147 DNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEA 226
Cdd:COG0154   83 DNIDTAGLPTTAGSKALEDYVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVPGGSSGGSA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 227 ALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAvmmpGPMARDVDSLALFMKAVLCDDM 306
Cdd:COG0154  163 AAVAAGLVPLALGSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGVVPLASSLDQI----GPLARTVRDAALLLDVIAGPDP 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 307 fQLDPTVPPVPFRDE-IYNSSKPLTIGFY-DTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGF 384
Cdd:COG0154  239 -RDSPLPPPPPVPPAlAGKDLKGLRIGVPkELGGGGPLDPDVRAAFEAAVKALEAAGAEVVEVSLPLLSDDYALAAYYLA 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 385 FADG------GSTLVDKFNADIVDPNlkqqmllykiptiVKKIItffmrpvfpRIANHVNAHcgvgsvkqLWKHNAAIKE 458
Cdd:COG0154  318 RFDGeryglrAADLYGKTRAEGFGPE-------------VKRRI---------MLGTYLLSA--------GYYDAYYRRA 367
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 459 YRCEYINEWKKL--NLDALLCPMLG-PAFNIGCPGKLFAG--FC-----FTMLFNILNFPAGVLPVNivtpedeeelkny 528
Cdd:COG0154  368 QKTLIRRAFDKLfeEVDVLLTPTTPtPAPKIGESESDGDDplEMylldvFTVPANLAGLPAISVPAG------------- 434
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148230949 529 kgyyndlwdkdvikgmEDGVGLPLAVQCVALPWQEEQCLRLMKEVENVTRGK 580
Cdd:COG0154  435 ----------------FTADGLPVGLQLIGPAFDDATLLRLAAALEQALGWH 470
gatA PRK00012
aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed
87-376 4.55e-41

aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed


Pssm-ID: 234572  Cd Length: 459  Bit Score: 154.12  E-value: 4.55e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  87 LKKGSLAAESVLVAYIEKALEVNKELNCltdFLSECEAQ-LQEVKK------QKEKGLLYGVPITLKDNVGYKGHDSHCG 159
Cdd:PRK00012   1 LKNKEISAVELTQAYLDRIEEVDPKLNA---FITVTEEEaLAQAKAadaklaAGEAGPLAGIPIAIKDNICTKGIRTTCA 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 160 ---LVQFLGIADqedSVIVQVLKKHGAVPFVKTNipqsMINF----DCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGG 232
Cdd:PRK00012  78 skiLENYVPPYD---ATVVEKLKAAGAVILGKTN----MDEFamgsSTENSAFGPTKNPWDLERVPGGSSGGSAAAVAAG 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 233 GAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLG---FStpvSGMKSAvmmpGPMARDVDSLALfmkavLCDDMFQL 309
Cdd:PRK00012 151 LAPAALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGliaFA---SSLDQI----GPFARTVEDAAL-----LLNAIAGH 218
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949 310 DP----TVP-PVP-FRDEIYNSSKPLTIGF---YDTDGYflpSPGMRRAIQETKALLEEAGHKLVPFSPPRIEYAL 376
Cdd:PRK00012 219 DPkdstSADvPVPdYTAALGKDIKGLKIGVpkeYFGEGL---DPEVKEAVEAAIKKLEDLGAEIVEVSLPHTKYAL 291
gatA TIGR00132
aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase ...
83-376 2.33e-39

aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit; In many species, Gln--tRNA ligase is missing. tRNA(Gln) is misacylated with Glu after which a heterotrimeric amidotransferase converts Glu to Gln. This model represents the amidase chain of that heterotrimer, encoded by the gatA gene. In the Archaea, Asn--tRNA ligase is also missing. This amidase subunit may also function in the conversion of Asp-tRNA(Asn) to Asn-tRNA(Asn), presumably with a different recognition unit to replace gatB. Both Methanococcus jannaschii and Methanobacterium thermoautotrophicum have both authentic gatB and a gatB-related gene, but only one gene like gatA. It has been shown that gatA can be expressed only when gatC is also expressed. In most species expressing the amidotransferase, the gatC ortholog is about 90 residues in length, but in Mycoplasma genitalium and Mycoplasma pneumoniae the gatC equivalent is as the C-terminal domain of a much longer protein. Not surprisingly, the Mycoplasmas also represent the most atypical lineage of gatA orthology. This orthology group is more narrowly defined here than in Proc Natl Acad Aci USA 94, 11819-11826 (1997). In particular, a Rhodococcus homolog found in association with nitrile hydratase genes and described as an enantiomer-selective amidase active on several 2-aryl propionamides, is excluded here. It is likely, however, that the amidase subunit GatA is not exclusively a part of the Glu-tRNA(Gln) amidotransferase heterotrimer and restricted to that function in all species. [Protein synthesis, tRNA aminoacylation]


Pssm-ID: 272925  Cd Length: 460  Bit Score: 149.03  E-value: 2.33e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   83 LVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSEcEAQLQEVK-KQKEKGLLYGVPITLKDNVGYKGHDSHCG-- 159
Cdd:TIGR00132   1 LRQLLKKKEISIKEVLEASLDRIEANKDKINAFLEVTVE-KALKQAKKlDKAILTPLAGIPIAVKDNISTKGIVTTCAsk 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  160 -LVQFLGIADqedSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGV 238
Cdd:TIGR00132  80 iLENYIPPYD---ATVIERLKQAGALIIGKTNMDEFAMGSSTETSAFGPTKNPWNLDRVPGGSSGGSAAAVAADLAPFSL 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  239 GTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAvmmpGPMARDVDSLALFMKAVLCDDMfqLDPT---VPP 315
Cdd:TIGR00132 157 GSDTGGSIRQPASFCGVVGFKPTYGRVSRYGLVAYASSLDQI----GPFARTVEDIALLLDVISGHDK--RDSTsakVPD 230
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949  316 VPFRDEIYNSSKPLTIG-----FYDTDgyflpsPGMRRAIQETKALLEEAGHKLVPFSPPRIEYAL 376
Cdd:TIGR00132 231 PEFFEELKKDLKGLKVGvvkefSEEMD------KEVQEKFENALEVLEELGAEIVEVSFPHVKYAL 290
PRK07487 PRK07487
amidase; Provisional
78-361 3.55e-35

amidase; Provisional


Pssm-ID: 236029  Cd Length: 469  Bit Score: 137.02  E-value: 3.55e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  78 LTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSE-CEAQLQEVKKQKEK----GLLYGVPITLKDNVGYK 152
Cdd:PRK07487   8 LSAAELAAAVRSRDVSAREAAEAALARLDAVNPAINAVVDHRPEeALAQADAVDAARARgddpGPLAGVPVTVKVNVDQA 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 153 GHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGG 232
Cdd:PRK07487  88 GFATTNGVRLQKDLIAPADSPVVDNLRKAGAVIIGRTNTPAFSYRWFTDNPLHGRTLNPWDPSLTPGGSSGGAAAAVAAG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 233 GAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAVM-MPGPMARDVDSLALFMKAvlcddMFQLDP 311
Cdd:PRK07487 168 IGAIAHGTDIGGSIRYPAYACGVHGLRPTLGRVPAYNASSPERPIGAQLMsVQGPLARTVADLRLALAA-----MAAPDP 242
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 148230949 312 TVP---PVPFRDeiynSSKPLTIGFYDTDGYFLPSPGMRRAIQETKALLEEAG 361
Cdd:PRK07487 243 RDPwwvPAPLEG----PPRPKRVALCVRPDGLDVDPEVEAALRDAARRLEDAG 291
PRK06170 PRK06170
amidase; Provisional
78-370 3.64e-32

amidase; Provisional


Pssm-ID: 235723  Cd Length: 490  Bit Score: 128.23  E-value: 3.64e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  78 LTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELN--CLTDFlsecEAQLQEVKK------QKEKGLLYGVPITLKDNV 149
Cdd:PRK06170  12 LPATELAAALAAGEVSSVELTDLAIARIERHDGKINaiVVRDF----DRARAAARAadaaraRGERGPLLGIPVTVKESF 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 150 GYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALI 229
Cdd:PRK06170  88 NVAGLPTTWGFPDLRDYVPAEDAVAVARLKAAGAVILGKTNVPLGLQDWQSYNEIYGTTNNPWDLARTPGGSSGGSAAAL 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 230 AGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPV-----SGMKSAVMmpGPMARDVDSLALfmkavLCD 304
Cdd:PRK06170 168 AAGFGALSIGSDIGGSLRVPAHYCGVYAHKPTLGLVPLRGHIPPPapalpGQADLAVA--GPMARSARDLAL-----LLD 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148230949 305 DMFQLDPTVPPVPFRDEI----YNSSKPLTIGFYDTDGyFLPS-PGMRRAIQETKALLEEAGHKLVPFSPP 370
Cdd:PRK06170 241 VMAGPDPLDGGVAYRLALpparHGRLKDFRVLVLDEHP-LLPTdAAVRAAIERLAAALADAGARVVRHSPL 310
PRK06169 PRK06169
putative amidase; Provisional
78-407 6.65e-31

putative amidase; Provisional


Pssm-ID: 180437  Cd Length: 466  Bit Score: 124.37  E-value: 6.65e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  78 LTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELN--CLTD---FLSECEAQLQEVKKQKEKGLLYGVPITLKD---NV 149
Cdd:PRK06169   7 LTAVELLAAYRRGELSPVEATQAVLDRIDRRDPAVNafCLVDaegALAAARASEERWRRGEPCGLLDGVPVSIKDiflTR 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 150 GY---KGhdSHCGLVQflGIADqEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEA 226
Cdd:PRK06169  87 GWptlRG--SRAIDAD--GPWD-VDAPAVARLREAGAVLLGKTTTPEFGWKGVTDSPLYGITRNPWDTRLTAGGSSGGAA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 227 ALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLgfstPVSGMKSaVMMPGPMARDVDSLALFMKAVLCDDm 306
Cdd:PRK06169 162 AAVALGMGPLSVGTDGGGSVRIPASFCGTFGFKPTFGRVPLY----PASPFGT-LAHVGPMTRTVADAALLLDVIARPD- 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 307 fQLDPTV---PPVPFRDEIYNSSKPLTIGFYDTDGYFLPSPGMRRAIQETKALLEEAGHKLV----PFSPPRieyalnEL 379
Cdd:PRK06169 236 -ARDWSAlppPTTSFLDALDRDVRGLRIAYSPTLGYVDVDPEVAALVAQAVQRLAALGARVEevdpGFSDPV------EA 308
                        330       340       350
                 ....*....|....*....|....*....|.
gi 148230949 380 cIRGFFADGGSTLVDKFNA---DIVDPNLKQ 407
Cdd:PRK06169 309 -FHVLWFAGAARLLRALPPgqrALLDPGLRR 338
PRK12470 PRK12470
amidase; Provisional
87-369 3.29e-30

amidase; Provisional


Pssm-ID: 171524  Cd Length: 462  Bit Score: 122.30  E-value: 3.29e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  87 LKKGSLAAESVLVAYIEKALEVNKELNCLTDFLSEC---EAQ-LQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQ 162
Cdd:PRK12470  18 LADGELTAPMLLEVYLQRIERLDSHLRAYRVVLFDRaraEAEaAQQRLDAGERLPLLGVPIAIKDDVDVAGEVTTYGSAG 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 163 FLGIADQeDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDV 242
Cdd:PRK12470  98 HGPAATS-DAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWDPNRTPGGSSGGSAAAVAAGLAPVALGSDG 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 243 LGSIRMPCSFCGICGLKPSGNRLSslgfSTPVSGMKSAVMMPGPMARDVDSLALFMKAVLC----DDMFQLDPTVPPVPF 318
Cdd:PRK12470 177 GGSIRIPSTWCGLFGLKPQRDRIS----LEPHDGAWQGLSVNGPIARSVMDAALLLDATTTvpgpEGEFVAAAAREPGRL 252
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 148230949 319 RdeIYNSSK-PLTIGFYdtdgyflPSPGMRRAIQETKALLEEAGHKLVPFSP 369
Cdd:PRK12470 253 R--IALSTRvPTPLPVR-------CGKQELAAVHQAGALLRDLGHDVVVRDP 295
PRK07486 PRK07486
amidase; Provisional
67-372 3.51e-27

amidase; Provisional


Pssm-ID: 236028  Cd Length: 484  Bit Score: 113.57  E-value: 3.51e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  67 HPELDTGHIVSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLT------DFLSECEAQLQEVKKQKEKGLLYG 140
Cdd:PRK07486   1 PASPPPDPIVRLSAHALSRAIRRRQVSCVEVMRAYLAHIERVNPAVNAIValrdrdALLAEAAEKDAALARGEYRGWLHG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 141 VPITLKDNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGG 220
Cdd:PRK07486  81 MPQAPKDLAPTKGIRTTLGSPIFADQVPQEDAIVVERMRAAGAIFIGKTNTPEFGLGSHTYNPVYGATRNPYDPSRSAGG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 221 SSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLsslgfstPvSGMKSAVMMP-----GPMARDVDSLA 295
Cdd:PRK07486 161 SSGGAAAALALRMLPVADGSDMMGSLRNPAAFNNVYGFRPSQGRV-------P-HGPGGDVFVQqlgteGPMGRTVEDVA 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 296 LfmkavLCDDMFQLDPTVP------PVPFRDEIYNSSKPLTIGFY-DTDGYFLPSPGMRRAIQETKALLEEAGHK----L 364
Cdd:PRK07486 233 L-----LLAVQAGYDPRDPlslaedPARFAQPLEADLRGKRIAWLgDWGGYLPMEAGVLELCEAALATLRELGCDveaaL 307

                 ....*...
gi 148230949 365 VPFSPPRI 372
Cdd:PRK07486 308 PAFPPERL 315
PRK07869 PRK07869
amidase; Provisional
83-370 1.15e-26

amidase; Provisional


Pssm-ID: 181154  Cd Length: 468  Bit Score: 112.00  E-value: 1.15e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  83 LVDQLKKGSLAAESVLVAYIEKALEVNKELNCL--TDFLsecEAQLQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGL 160
Cdd:PRK07869  20 LAEAIRAGRVSAAEVVEAAIARAEAVNPALNALayAAFD---RARDRAARPGSQGGFFSGVPTFIKDNVDVAGLPTMHGS 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 161 VQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGT 240
Cdd:PRK07869  97 DAWTPRPAKADSDFARQFLATGLISLGKTQLPEFGFSASTEHPRLGPVRNPWNTDYSAGASSGGSAALVAAGVVPIAHAN 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 241 DVLGSIRMPCSFCGICGLKPSGNRLsslgfstpvSGMKSAVMMP------GPMARDVDSLALFMKAVlcdDMFQLDPTVP 314
Cdd:PRK07869 177 DGGGSIRIPAACCGLVGLKPSRGRL---------PLDPELRRLPvnivanGVLTRTVRDTAAFYREA---ERYYRNPKLP 244
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949 315 PVpfRDEIYNSSKPLTIGFYdTDGYFLP--SPGMRRAIQETKALLEEAGHKLVPFSPP 370
Cdd:PRK07869 245 PI--GDVTGPGKQRLRIAVV-TDSVTGReaDPEVREAVLATARLLEELGHRVEPVDLP 299
PRK06529 PRK06529
amidase; Provisional
83-377 2.39e-26

amidase; Provisional


Pssm-ID: 180608  Cd Length: 482  Bit Score: 111.07  E-value: 2.39e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  83 LVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDflSECEAQLQEVKKQKEKGLLY-GVPITLKDnVG--YKGHDSHCG 159
Cdd:PRK06529   9 MAQAVQQGQVTPLELVTQAIYKAKKLNPTLNAIVS--ERYEEALEEAKQRDFSGKPFaGVPIFLKD-LGqeLKGQLSTSG 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 160 LVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVG 239
Cdd:PRK06529  86 SRLFKNYQATKTDLYVKRLEDLGFIILGRSNTPEFGFKNISDSSLHGPVNLPFDNSRNAGGSSGGAAALVSSGIVALAAA 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 240 TDVLGSIRMPCSFCGICGLKPSGNRL--------SSLGFSTPVSGMKSavmmpgpmARDVDSLALFMKavlcddMFQLDP 311
Cdd:PRK06529 166 SDGGGSIRIPASFNGLIGLKPSRGRIpvgpgsyrGWQGASVHFALTKS--------VRDTRRLLYYLQ------MYQMES 231
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148230949 312 TVPPVPF-RDEIYNS-SKPLTIGFYDTDGYFLP-SPGMRRAIQETKALLEEAGHKLVPFSppriEYALN 377
Cdd:PRK06529 232 PFPLATLsKESLFQSlQRPLKIAFYQRSPDGSPvSLDAAKALKQAVTFLREQGHEVVELE----EFPLD 296
amido_AtzE TIGR02715
amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, ...
79-340 2.02e-25

amidohydrolase, AtzE family; Members of this protein family are aminohydrolases related to, but distinct from, glutamyl-tRNA(Gln) amidotransferase subunit A. The best characterized member is the biuret hydrolase of Pseudomonas sp. ADP, which hydrolyzes ammonia from the three-nitrogen compound biuret to yield allophanate. Allophanate is also an intermediate in urea degradation by the urea carboxylase/allophanate hydrolase pathway, an alternative to urease. [Unknown function, Enzymes of unknown specificity]


Pssm-ID: 274267  Cd Length: 452  Bit Score: 107.95  E-value: 2.02e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949   79 TLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDF-----LSECEAQLQEVKKQKEKGLLYGVPITLKDNVGYKG 153
Cdd:TIGR02715   1 SIVEIAGAIRSGRVSARAVAEATLARINQADGGLNAFTAVtaeraLADAARIDADLAAGSPLGPLAGVPFAVKNLFDVAG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  154 HDSHCGLVQFLGIAD-QEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGG 232
Cdd:TIGR02715  81 LTTLAGAKINRDLAPaKRDATLVQRLSAAGAVLVGALNMDEFAYGFTTENAHYGPTRNPHDLTRIAGGSSGGSAAAVAAG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  233 GAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAvmmpGPMARDVDSLAL---FMKAVLCDDMFQ- 308
Cdd:TIGR02715 161 LVPFSLGSDTNGSIRVPASLCGVFGLKPTYGRLSRQGVFPFVASLDHV----GPFARSVEDLALaydVMQGPDPQDPFCt 236
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 148230949  309 ---LDPTVPPVPfrdeiyNSSKPLTIGFydTDGYF 340
Cdd:TIGR02715 237 drpAEPTVPLLP------AGISGLRIAV--LGGWF 263
PRK09201 PRK09201
amidase; Provisional
77-340 1.28e-23

amidase; Provisional


Pssm-ID: 236409  Cd Length: 465  Bit Score: 102.74  E-value: 1.28e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  77 SLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKELNCLTDF-----LSECEAQLQEVKKQKEKGLLYGVPITLKDNVGY 151
Cdd:PRK09201   6 SLSAAEIAAAVRAGELSARAVAQATLARIARANPQLNAFTAVtaeraLAEAARIDAARAAGEPLGPLAGVPFAVKNLFDV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 152 KGHDSHCG--LVQFLGIADQeDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALI 229
Cdd:PRK09201  86 AGLTTLAGskINRDRPPATR-DATAVRRLEAAGAVLVGALNMDEYAYGFTTENSHYGATRNPHDLTRIAGGSSGGSAAAV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 230 AGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGfSTPVSGMKSAVmmpGPMARDVDSLALF---MKAVLCDDM 306
Cdd:PRK09201 165 AAGLVPFTLGSDTNGSIRVPASLCGIFGLKPTYGRLSRAG-SFPFVASLDHI---GPFARSVADLALVydvLQGPDPQDP 240
                        250       260       270
                 ....*....|....*....|....*....|....
gi 148230949 307 FQLDPtvPPVPFRDEIYNSSKPLTIGFydTDGYF 340
Cdd:PRK09201 241 FQADR--PAEPTAPLLDRGAEGLRIAV--LGGYF 270
PRK06061 PRK06061
amidase; Provisional
138-370 1.95e-19

amidase; Provisional


Pssm-ID: 235686  Cd Length: 483  Bit Score: 90.14  E-value: 1.95e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 138 LYGVPITLKDNVGYKGHDSHCGLVQFLGIADqEDSVIVQVLKKHGAVPFVKTNIPQ-SMINFdCSNSIFGQTLNPHNHKK 216
Cdd:PRK06061  82 LLGVPIAVKDDVDVAGVPTAFGTAGEVPPAT-ADSEVVRRLRAAGAVIVGKTNTCElGQWPF-TSGPAFGHTRNPWSRDH 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 217 TCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGmksaVMMPGPMARDVDSLAL 296
Cdd:PRK06061 160 TPGGSSGGSAAAVAAGLVTAAIGSDGAGSVRIPAAWTHLVGIKPQRGRISTWPLPEAFNG----LTVNGPLARTVADAAL 235
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 297 FMKAV---LCDDMFQLDPTV-------PPVPFRdeIYNSSKPLTIGFYDTdgyflPSPGMRRAIQETKALLEEAGHKLVP 366
Cdd:PRK06061 236 LLDAAsgnHPGDRHRPPPVTvsdavgrAPGPLR--IALSTRFPFTGFPAK-----LHPEIRAAVRRVAEQLALLGHTVVP 308

                 ....
gi 148230949 367 FSPP 370
Cdd:PRK06061 309 ADPD 312
PRK07042 PRK07042
amidase; Provisional
136-369 4.19e-19

amidase; Provisional


Pssm-ID: 235915  Cd Length: 464  Bit Score: 88.88  E-value: 4.19e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 136 GLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQ-SMINFDCSnSIFGQTLNPHNH 214
Cdd:PRK07042  70 GPLDGVPVTIKENIATRGVPVPLGTAATDLPPAAADAPPAARLREAGAVILAKTTMPDyGMLSSGLS-SFHGLTRNPWDL 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 215 KKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSslgFSTPVSGmKSAvmmpGPMARDVDSL 294
Cdd:PRK07042 149 DQNPGGSSAGAGAAAAAGYGPLHLGTDIGGSVRLPAGWCGIVGLKPSLGRIP---IDPPYTG-RCA----GPMTRTVDDA 220
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949 295 ALFMKAVLCDDmfQLDPT-VPPVPFRDEIYNSS-KPLTIGFYDTDGYFLP-SPGMRRAIQETKALLEEAGHKLVPFSP 369
Cdd:PRK07042 221 ALLMSVLSRPD--ARDGTsLPPQDIDWSDLDIDvRGLRIGLMLDAGCGLAvDPEVRAAVEAAARRFEAAGAIVEPVPP 296
PRK08137 PRK08137
amidase; Provisional
76-366 6.67e-18

amidase; Provisional


Pssm-ID: 236161  Cd Length: 497  Bit Score: 85.59  E-value: 6.67e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  76 VSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNK---------ELNclTDFLSECEAQLQEVKKQKEKGLLYGVPITLK 146
Cdd:PRK08137   4 LEERAGALQAAMPAGAAPASQLTRAYLQRIARIDRdgprlnaviELN--PDAEADAAALDAERKAGKVRGPLHGIPVLLK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 147 DNVgykghDSHCGLVQFLG---IAD---QEDSVIVQVLKKHGAVPFVKTNIPQsMINFDCSNSIFG------QTLNPHNH 214
Cdd:PRK08137  82 DNI-----DAADPMPTTAGslaLAGnrpTRDAFLVARLRDAGAVILGKANLSE-WANFRSTRSSSGwsarggLTRNPYAL 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 215 KKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSGMKSAVmmpGPMARDVDSL 294
Cdd:PRK08137 156 DRSPCGSSSGSGAAVAAGLAAVAIGTETDGSITCPAAINGLVGLKPTVGLVSRDGI-VPISHSQDTA---GPMTRTVADA 231
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 148230949 295 ALFMKAVLCDDmfQLDPTVPPVPFRDEIY------NSSKPLTIGFydTDGYFLPSPGMRRAIQETKALLEEAGHKLVP 366
Cdd:PRK08137 232 AAVLTAIAGGD--PADPATASAPAPAVDYvaaldaDALRGARLGV--ARNYLGYHPEVDAQFERALAELKAAGAVVID 305
PRK06828 PRK06828
amidase; Provisional
78-301 3.56e-17

amidase; Provisional


Pssm-ID: 180715  Cd Length: 491  Bit Score: 83.33  E-value: 3.56e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  78 LTLSQLVDQLKKGSLAAESVLVAYIEKALEVNK---------ELNclTDFLSECEAQLQEVKKQKEKGLLYGVPITLKDN 148
Cdd:PRK06828  13 LTIHDIQTAMEDGKLTSKELVMYYLHRIAKYDQdgpkinsilEIN--PDAIFIAEALDHERKIKGVRGPLHGIPVLLKDN 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 149 VGY--KGHDShCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQ--SMINFDCSN---SIFGQTLNPHNHKK---TC 218
Cdd:PRK06828  91 IETndSMHTS-AGTIALEQHISSEDAFLVTKLREAGAVILGKANMTElaNFMSFEMWAgysARGGQTINPYGTGEddmFV 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 219 GGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSGMKSAVmmpGPMARDVDSLALFM 298
Cdd:PRK06828 170 GGSSTGSAIAVAANFTVVSVGTETDGSILSPAVQNSVVGIKPTVGLISRRGI-IPFTYSQDTA---GPFARTVTDAAILL 245

                 ...
gi 148230949 299 KAV 301
Cdd:PRK06828 246 GSL 248
PRK06707 PRK06707
amidase; Provisional
75-331 9.57e-17

amidase; Provisional


Pssm-ID: 235855  Cd Length: 536  Bit Score: 81.88  E-value: 9.57e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  75 IVSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNKE---LNCLTDF----LSECEAQLQEVKKQKEKGLlYGVPITLKD 147
Cdd:PRK06707  68 VVNATVDELQKMIDDGKLSYEELTSIYLFRIQEHDQNgitLNSVTEInpnaMEEARKLDQERSRNKKSNL-YGIPVVVKD 146
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 148 NVG-YKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQ-----SMINFDCSNSIFGQTLNPHNHKK-TCGG 220
Cdd:PRK06707 147 NVQtAKVMPTSAGTYVLKDWIADQDATIVKQLKEEGAFVLGKANMSEwanylSFTMPSGYSGKKGQNLNPYGPIKfDTSG 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 221 SSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSGMKSAVmmpGPMARDVDSLALFMKA 300
Cdd:PRK06707 227 SSSGSATVVAADFAPLAVGTETTGSIVAPAAQQSVVGLRPSLGMVSRTGI-IPLAETLDTA---GPMARTVKDAATLFNA 302
                        250       260       270
                 ....*....|....*....|....*....|.
gi 148230949 301 VLCDDmfQLDPTVPPVPFRDEIyNSSKPLTI 331
Cdd:PRK06707 303 MIGYD--EKDVMTEKVKDKERI-DYTKDLSI 330
PRK07056 PRK07056
amidase; Provisional
138-386 1.30e-13

amidase; Provisional


Pssm-ID: 235921  Cd Length: 454  Bit Score: 71.89  E-value: 1.30e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 138 LYGVPITLKDNVGYKGHDSHCGLVqflGIAD----QEDSVIVQVLKKHGAVPFVKTNipqsMINFDCS----NSIFGQTL 209
Cdd:PRK07056  72 LAGIPVSVKDLFDVAGQVTRAGSR---VLADappaAADAPAVARLRRAGAVLIGRTN----MTEFAFSglglNPHYGTPR 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 210 NPHNHKKT----CGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGfSTPVS-GMKSAvmmp 284
Cdd:PRK07056 145 NPWRRDVGdgriPGGSSSGAAVSVADGMAAAALGTDTGGSIRIPAALCGLTGFKPTARRVPLQG-AVPLStTLDSI---- 219
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 285 GPMARDVDSLALfMKAVLCDdmfqlDPTVPPVPfrdeiynssKPLT-IGFYDTDGYFLPS--PGMRRAIQETKALLEEAG 361
Cdd:PRK07056 220 GPLARSVACCAL-VDAVLAG-----EEPVVPAA---------RPLEgLRLAVPTTVVLDGldATVAAAFERALKRLSAAG 284
                        250       260
                 ....*....|....*....|....*
gi 148230949 362 HKLVPFSPPRIEyALNELCIRGFFA 386
Cdd:PRK07056 285 AIIEEIAFPELA-ELAEINAKGGFS 308
PRK08310 PRK08310
amidase; Provisional
136-373 4.42e-12

amidase; Provisional


Pssm-ID: 181375  Cd Length: 395  Bit Score: 66.55  E-value: 4.42e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 136 GLLYGVPITLKDNVGYKGHDSHCGLVQFL---GIADQeDSVIVQVLKKHGAVpFV-KTNIPQSMINFDCSNSIFGQTLNP 211
Cdd:PRK08310  24 GPLAGLRFAVKDVFDVAGYVTGCGNPDWLaesPVATR-TAPAVEKLLAAGAR-FVgKTQTDELAFSLNGQNAHYGTPVNP 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 212 HNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFStPVSGMKSAVmmpGPMARDV 291
Cdd:PRK08310 102 AAPDRVPGGSSSGSAAAVAGGLADFALGTDTGGSVRAPASFCGLYGLRPTHGRISLEGVM-PLAPSFDTV---GWFARDI 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 292 DSLALFMKAVLCDDMFQLDPTVPPVpfrdeiynsskpltigfYDTDGYFLPSPGMRRAIQETKALLEEAGHKLVPFSPPR 371
Cdd:PRK08310 178 ALLERVGEVLLGDDAQEFPLTQRLL-----------------IPVDLFALLDPAVRAALEAALARLRPHLGPAKPASVPP 240

                 ..
gi 148230949 372 IE 373
Cdd:PRK08310 241 LS 242
PRK06102 PRK06102
hypothetical protein; Provisional
121-361 8.79e-12

hypothetical protein; Provisional


Pssm-ID: 235698  Cd Length: 452  Bit Score: 65.83  E-value: 8.79e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 121 ECEAQLQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIAD-QEDSVIVQVLKKHGAVPFVKTNipqsMINFD 199
Cdd:PRK06102  53 EAEASSARWRAGRSLGLLDGIPIAWKDLFDVAGSVTTAGSVVLANAAPaSRDAAVVALLARAGMVSIGRTN----MSEFA 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 200 CS----NSIFGQTLNPHN--HKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGfstp 273
Cdd:PRK06102 129 FSglglNPHYGTPVNPRStdVPRIPGGSSSGSAVAVAAGLVPVAMGTDTGGSVRIPAAFNGLVGYKATRGRYSMDG---- 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 274 vsgmksaVMmpgPMARDVDSL---------ALFMKAVLCDDMfqlDPTVPPVPFRDEIYnsSKPLTIGFYDTDgyflpsP 344
Cdd:PRK06102 205 -------VF---PLAKSLDSLgplcrsvrdAVWIDAAMRGLT---APDVVRRPLAGLRL--VVPETVVFDDAE------P 263
                        250
                 ....*....|....*..
gi 148230949 345 GMRRAIQETKALLEEAG 361
Cdd:PRK06102 264 GVRAAFEAAVERLQAAG 280
PRK07139 PRK07139
amidase; Provisional
130-272 1.49e-10

amidase; Provisional


Pssm-ID: 235945  Cd Length: 439  Bit Score: 61.99  E-value: 1.49e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 130 KKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTL 209
Cdd:PRK07139  29 EKNNKDGPLANCVFTIKDNFATSEGPTHASSKSLENFKPSYNATVVQKLINAGAKPVAKVHCDELGLGGTGLFSAFGLIK 108
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148230949 210 NPHNHKKTCGGSSGGEAALIaGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFST 272
Cdd:PRK07139 109 NPLDSSKLVGGSSSGSAATF-NKNISFAIGSDTGDSVRLPASFIGKVGFKPSYGAISRYGLFA 170
PRK08186 PRK08186
allophanate hydrolase; Provisional
76-369 4.89e-10

allophanate hydrolase; Provisional


Pssm-ID: 236177  Cd Length: 600  Bit Score: 60.63  E-value: 4.89e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  76 VSLTLSQLVDQLKKGSLAAESVLVAYIEKALEVNK-ELncltdFLS-----ECEAQLQEVKKQKEKGL-LYGVPITLKDN 148
Cdd:PRK08186   5 TDLTLASLRAAYRAGTLTPRAVVAALYARIAAVDDpEV-----WIHlrpeaDLLAQAAALEARDPAALpLYGVPFAVKDN 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 149 VGYKGHDSHCGLVQFLGIADQeDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEA-- 226
Cdd:PRK08186  80 IDVAGLPTTAACPAFAYTPER-DATVVARLRAAGAIVIGKTNLDQFATGLVGTRSPYGAVRNAFDPEYVSGGSSSGSAva 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 227 --------ALiagggavlgvGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGfstpvsgmksAVmmpgPMARDVDSLALFm 298
Cdd:PRK08186 159 valglvsfAL----------GTDTAGSGRVPAAFNNIVGLKPTLGLLSTRG----------VV----PACRTLDCVSVF- 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 299 kAVLCDDMFQL-------DPTVP-----PVPFRDEIynsSKPLTIGFYDTDGY-FLPSPGMRRAIQETKALLEEAGHKLV 365
Cdd:PRK08186 214 -ALTVDDADAVlavmagfDPADPysranPADAPAAL---PAGPRVGVPRAAQLeFFGDAEAEAAFAAALARLEALGAELV 289

                 ....*.
gi 148230949 366 P--FSP 369
Cdd:PRK08186 290 EidFSP 295
PRK05962 PRK05962
amidase; Validated
136-364 9.75e-09

amidase; Validated


Pssm-ID: 168315  Cd Length: 424  Bit Score: 56.33  E-value: 9.75e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 136 GLLYGVPITLKDNVGYKGHDSHCG-LVQFLGIADQEDSVIVQVLKKHGAVPFVKTNipqsMINFDCSnsifGQTLNPH-- 212
Cdd:PRK05962  44 GPLDGRIVSIKDLFDVAGEPTLAGsVIRRDAPPAGADALIVQRLRNAGAVIIGKTH----MTEFAFT----PVGLNPHyg 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 213 ------NHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGfSTPVSGMKSAVmmpGP 286
Cdd:PRK05962 116 epgnaiDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVRIPAALNGLVGFKPTARRIPLEG-AFPLSPSLDSI---GP 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 287 MARDVDSLALfMKAVLCDDMFQLdptVPPVPFRDeiynsskpLTIG------FYDTDgyflpsPGMRRAIQETKALLEEA 360
Cdd:PRK05962 192 LARTVADCAA-ADAVMAGEKPIP---LEVLPVAG--------LRIGlpkgylLADME------PDVAAAFEASLAALEKA 253

                 ....
gi 148230949 361 GHKL 364
Cdd:PRK05962 254 GARI 257
PLN02722 PLN02722
indole-3-acetamide amidohydrolase
175-299 2.28e-08

indole-3-acetamide amidohydrolase


Pssm-ID: 166363  Cd Length: 422  Bit Score: 55.28  E-value: 2.28e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 175 VQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCG 254
Cdd:PLN02722  66 VLAVLRGGATCVGKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCG 145
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 148230949 255 ICGLKPSGNRLSSLGFStpvsgmksavmmpgPMARDVDSLALFMK 299
Cdd:PLN02722 146 IFGFRPSHGAVSTVGVI--------------PMAQSFDTVGWFAR 176
PRK06565 PRK06565
amidase; Validated
74-314 6.75e-07

amidase; Validated


Pssm-ID: 180626  Cd Length: 566  Bit Score: 50.54  E-value: 6.75e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  74 HIVSLTLSQLVDQLKKGSLAAESVLVAYIEK-----ALEVNKELNCLT----DFLSECEAQLQEVKKQKEKGLLYGVPIT 144
Cdd:PRK06565   3 EVTEVSIAELRAALESGRTTAVELVKAYLARidaydGPATGTALNAVVvrnpDALKEAEASDARRARGETLGPLDGIPYT 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 145 LKDNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPqSMINFDCSNSIFGQTLNPHN-HKKTC---GG 220
Cdd:PRK06565  83 AKDSYLVKGLTAASGSPAFKDLVAQRDAFTIERLRAAGAICLGKTNMP-PMANGGMQRGVYGRAESPYNaAYLTApfaSG 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 221 SSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAVmmpgPMARDVDSLALFMKA 300
Cdd:PRK06565 162 SSNGAGTATAASFSAFGLAEETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVV----PYARTMADLLEVLDV 237
                        250       260
                 ....*....|....*....|
gi 148230949 301 VLCD------DMFQLDPTVP 314
Cdd:PRK06565 238 IVADdpdtrgDLWRLQPWVP 257
PRK07488 PRK07488
indole acetimide hydrolase; Validated
75-380 3.43e-34

indole acetimide hydrolase; Validated


Pssm-ID: 236030 [Multi-domain]  Cd Length: 472  Bit Score: 133.94  E-value: 3.43e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  75 IVSLTLSQLVDQLKKGSLAAESVLVAYIEKAlEVNKELNCLTDFlsECEAQLQEVKK---QKEKG---LLYGVPITLKDN 148
Cdd:PRK07488   8 VASLSLTEAAAALRSGRLSCLELVEALLARA-AALAPLNAFTTV--DAEGALAAARRidaQRAAGaalLLAGVPIVIKDN 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 149 VGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAAL 228
Cdd:PRK07488  85 INTAGMPTTAGTPALLGFVPATDAPVVQRLLDAGAVPLGKANMHELAFGITSNNGAFGAVRNPYDPARIAGGSSGGTAAA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 229 IAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSGMKSAVmmpGPMARDVDSLALfMKAVLCDDmfq 308
Cdd:PRK07488 165 VAARLAPAGLGTDTGGSVRIPAALCGVVGLRPTVGRYSGDGV-VPISHTRDTV---GPIARSVADLAL-LDAVITGD--- 236
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148230949 309 lDPTVPPVPFRdeiynsskPLTIGFYDTdGYFLP-SPGMRRAIQETKALLEEAGHKLVPFSPPRIEyALNELC 380
Cdd:PRK07488 237 -AALPAPVALA--------GLRLGVPAA-PFWDGlDPDVAAVAEAALAKLAAAGVTFVELDLPGLH-ELNEAV 298
PRK07235 PRK07235
amidase; Provisional
131-370 1.25e-16

amidase; Provisional


Pssm-ID: 235979 [Multi-domain]  Cd Length: 502  Bit Score: 81.59  E-value: 1.25e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 131 KQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNSIFGQTLN 210
Cdd:PRK07235  81 KGAAEGKLAGKTVALKDNVAVAGVPMMNGSSTLEGFVPSFDATVVTRLLDAGATIVGKATCEDLCFSGGSHTSDPGPVHN 160
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 211 PHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSgnrlSSLgfsTPVSGmksavMMP------ 284
Cdd:PRK07235 161 PRDPGYSAGGSSSGSAALVAAGEVDMAIGGDQGGSIRIPSAWCGIYGMKPT----HGL---VPYTG-----AFPiertid 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 285 --GPMARDVDSLALFMKAVLCDDmfQLDP----TVPPVPFRDEIYNSSKPLTIGFYdTDGYFLPS--PGMRRAIQETKAL 356
Cdd:PRK07235 229 hlGPMTATVRDNALLLEVIAGRD--GLDPrqpaQPPVDDYTAALDRGVKGLKIGIL-REGFGLPNsePEVDEAVRAAAKR 305
                        250
                 ....*....|....
gi 148230949 357 LEEAGHKLVPFSPP 370
Cdd:PRK07235 306 LEDLGATVEEVSIP 319
PRK11910 PRK11910
amidase; Provisional
80-302 3.67e-16

amidase; Provisional


Pssm-ID: 183377 [Multi-domain]  Cd Length: 615  Bit Score: 80.46  E-value: 3.67e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  80 LSQLV--DQLKKGSLAAesVLVAYIEKALEVNKELNCLTDFLSECEAQLQEVKKQKE--KGLLYGVPITLKDNVGYKGHD 155
Cdd:PRK11910 170 LQQLIatKQLSYKELAG--IYLNRIKKYDQNGLNLNAITEINPTIIAEAEQLDKENTtnKSALYGMPVLLKDNIGTKELP 247
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949 156 SHCGLVQFLGIADQEDSVIVQVLKKHGAVPFVKTNIPQ--SMINFDCSNSIF---GQTLNPHNHKKTCGGSSGGEAALIA 230
Cdd:PRK11910 248 TSAGTVALKDWVIGKDATIVENLKANGALILGKTNMSEwaAGMDEDLPNGYSgkkGQSKNPYSSNLDPSGSSSGSATAAT 327
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148230949 231 GGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFsTPVSgmkSAVMMPGPMARDVDSLALFMKAVL 302
Cdd:PRK11910 328 SDFAAIAIGTETNGSIITPASAQSAVGYKPSQGLVNNKGI-IPLS---SRFDTPGPLTRTVNDAYLTTNALT 395
allophanate_hyd TIGR02713
allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent ...
124-269 1.04e-15

allophanate hydrolase; Allophanate hydrolase catalyzes the second reaction in an ATP-dependent two-step degradation of urea to ammonia and C02, following the action of the biotin-containing urea carboxylase. The yeast enzyme, a fusion of allophanate hydrolase to urea carboxylase, is designated urea amidolyase. [Central intermediary metabolism, Nitrogen metabolism]


Pssm-ID: 274265 [Multi-domain]  Cd Length: 561  Bit Score: 78.92  E-value: 1.04e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230949  124 AQLQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIADqEDSVIVQVLKKHGAVPFVKTNIPQSMINFDCSNS 203
Cdd:TIGR02713  18 AALDARDARPERLPLYGVPFAVKDNIDVAGLPTTAACPAFAYTPE-EDATVVALLRAAGAIVVGKTNLDQFATGLVGTRS 96
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148230949  204 IFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLG 269
Cdd:TIGR02713  97 PYGAVRNAFDPAYISGGSSSGSAVAVARGLVPFALGTDTAGSGRVPAALNNIVGLKPTKGLVSTTG 162
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH