NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148230304|ref|NP_001087579|]
View 

Protein Classification

MC/SLC25 family protein (domain architecture ID 10445172)

MC (mitochondrial carrier)/SLC25 (solute carrier 25) family protein which transfers molecules across the membranes of the mitochondria

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Mito_carr pfam00153
Mitochondrial carrier protein;
138-217 1.19e-26

Mitochondrial carrier protein;


:

Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 98.47  E-value: 1.19e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  138 IPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATFAT 217
Cdd:pfam00153   3 FLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQGGSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAAIYFGT 82
Mito_carr pfam00153
Mitochondrial carrier protein;
36-128 9.73e-25

Mitochondrial carrier protein;


:

Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 93.84  E-value: 9.73e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304   36 TPLNQFLAGAAAGSIQCVICCPMELAKTRLQLQGtgeyKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFG 115
Cdd:pfam00153   2 SFLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQG----GSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAA 77
                          90
                  ....*....|...
gi 148230304  116 FYFLTYDYLSRYL 128
Cdd:pfam00153  78 IYFGTYETLKRLL 90
 
Name Accession Description Interval E-value
Mito_carr pfam00153
Mitochondrial carrier protein;
138-217 1.19e-26

Mitochondrial carrier protein;


Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 98.47  E-value: 1.19e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  138 IPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATFAT 217
Cdd:pfam00153   3 FLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQGGSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAAIYFGT 82
Mito_carr pfam00153
Mitochondrial carrier protein;
36-128 9.73e-25

Mitochondrial carrier protein;


Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 93.84  E-value: 9.73e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304   36 TPLNQFLAGAAAGSIQCVICCPMELAKTRLQLQGtgeyKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFG 115
Cdd:pfam00153   2 SFLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQG----GSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAA 77
                          90
                  ....*....|...
gi 148230304  116 FYFLTYDYLSRYL 128
Cdd:pfam00153  78 IYFGTYETLKRLL 90
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
42-208 1.07e-13

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 69.03  E-value: 1.07e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  42 LAGAAAGSIQCVICCPMELAKTRLqlqGTGEYKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFGFYFLTY 121
Cdd:PTZ00169 118 LSGGLAGASSLLIVYPLDFARTRL---ASDIGKGGDREFTGLFDCLMKISKQTGFLSLYQGFGVSVQGIIVYRGAYFGLY 194
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304 122 DYLSRYLSCEINDTFIIPKLLFAGGMSgIVSWLSTYPIDVIKSR-LQADGIGGVNN--YNGIMDCVRKSYKEEGWRVFSR 198
Cdd:PTZ00169 195 DSAKALLFGNDKNTNILYKWAVAQTVT-ILAGLISYPFDTVRRRmMMMSGRKAKSEiqYTGTLDCWKKILKNEGLGGFFK 273
                        170
                 ....*....|
gi 148230304 199 GLTSTLLRAF 208
Cdd:PTZ00169 274 GAWANVLRGA 283
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
144-216 1.17e-06

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 48.23  E-value: 1.17e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148230304 144 AGGMSGIVSWLSTYPIDVIKSRLQA-DGI-----GGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATFA 216
Cdd:PTZ00169  13 MGGISAAISKTAVAPIERVKMLIQTqDSIpeiksGKVPRYSGIVNCFRRVSKEQGVLSLWRGNTANVIRYFPTQAFNFA 91
 
Name Accession Description Interval E-value
Mito_carr pfam00153
Mitochondrial carrier protein;
138-217 1.19e-26

Mitochondrial carrier protein;


Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 98.47  E-value: 1.19e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  138 IPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATFAT 217
Cdd:pfam00153   3 FLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQGGSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAAIYFGT 82
Mito_carr pfam00153
Mitochondrial carrier protein;
36-128 9.73e-25

Mitochondrial carrier protein;


Pssm-ID: 333882 [Multi-domain]  Cd Length: 92  Bit Score: 93.84  E-value: 9.73e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304   36 TPLNQFLAGAAAGSIQCVICCPMELAKTRLQLQGtgeyKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFG 115
Cdd:pfam00153   2 SFLASLLAGGIAGAIAVTVTYPLDVVKTRLQAQG----GSGKSKGRGILDCFKKIYKEEGIRGLYKGLLPNLLRVAPAAA 77
                          90
                  ....*....|...
gi 148230304  116 FYFLTYDYLSRYL 128
Cdd:pfam00153  78 IYFGTYETLKRLL 90
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
42-208 1.07e-13

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 69.03  E-value: 1.07e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  42 LAGAAAGSIQCVICCPMELAKTRLqlqGTGEYKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFGFYFLTY 121
Cdd:PTZ00169 118 LSGGLAGASSLLIVYPLDFARTRL---ASDIGKGGDREFTGLFDCLMKISKQTGFLSLYQGFGVSVQGIIVYRGAYFGLY 194
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304 122 DYLSRYLSCEINDTFIIPKLLFAGGMSgIVSWLSTYPIDVIKSR-LQADGIGGVNN--YNGIMDCVRKSYKEEGWRVFSR 198
Cdd:PTZ00169 195 DSAKALLFGNDKNTNILYKWAVAQTVT-ILAGLISYPFDTVRRRmMMMSGRKAKSEiqYTGTLDCWKKILKNEGLGGFFK 273
                        170
                 ....*....|
gi 148230304 199 GLTSTLLRAF 208
Cdd:PTZ00169 274 GAWANVLRGA 283
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
41-199 2.43e-12

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 64.79  E-value: 2.43e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304  41 FLAGAAAGSIQCVICCPMELAKTRLQLQGTG-EYKS-KSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFGFYF 118
Cdd:PTZ00169  11 FLMGGISAAISKTAVAPIERVKMLIQTQDSIpEIKSgKVPRYSGIVNCFRRVSKEQGVLSLWRGNTANVIRYFPTQAFNF 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304 119 LTYDYLSRYLSCEINDT----FIIPKLLfAGGMSGIVSWLSTYPIDVIKSRLQAD-GIGGVNNYNGIMDCVRKSYKEEGW 193
Cdd:PTZ00169  91 AFKDYFKNMFPKYNQKTdfwkFFGVNIL-SGGLAGASSLLIVYPLDFARTRLASDiGKGGDREFTGLFDCLMKISKQTGF 169

                 ....*.
gi 148230304 194 RVFSRG 199
Cdd:PTZ00169 170 LSLYQG 175
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
144-216 1.17e-06

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 48.23  E-value: 1.17e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148230304 144 AGGMSGIVSWLSTYPIDVIKSRLQA-DGI-----GGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATFA 216
Cdd:PTZ00169  13 MGGISAAISKTAVAPIERVKMLIQTqDSIpeiksGKVPRYSGIVNCFRRVSKEQGVLSLWRGNTANVIRYFPTQAFNFA 91
PTZ00169 PTZ00169
ADP/ATP transporter on adenylate translocase; Provisional
1-111 1.32e-06

ADP/ATP transporter on adenylate translocase; Provisional


Pssm-ID: 240302 [Multi-domain]  Cd Length: 300  Bit Score: 48.23  E-value: 1.32e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148230304   1 MGLYKGIGSPMMGLTFINALVFGVQGNTLRYL-GKDTPLNQFLAGAAAGSIQC---VICCPMELAKTRLQLQgTGEYKSK 76
Cdd:PTZ00169 170 LSLYQGFGVSVQGIIVYRGAYFGLYDSAKALLfGNDKNTNILYKWAVAQTVTIlagLISYPFDTVRRRMMMM-SGRKAKS 248
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 148230304  77 SKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRET 111
Cdd:PTZ00169 249 EIQYTGTLDCWKKILKNEGLGGFFKGAWANVLRGA 283
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH