NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148229671|ref|NP_001081211|]
View 

presenilin-2 [Xenopus laevis]

Protein Classification

Presenilin domain-containing protein (domain architecture ID 10471201)

Presenilin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
85-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


:

Pssm-ID: 279427  Cd Length: 407  Bit Score: 567.22  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   85 KYGARHVIMLFVPVTLCMVVVVATIKSVSFYT--EKDGQ-LIYTPFSEDTTSVGERLLNSVLNTLIMISVILVMTIFLVL 161
Cdd:pfam01080   1 KYGAKQVIRLFVPVSLCMLLVVATIRSLSFYSsqVNSGAsLVYTPFHSSSDSTGTKLWGSLLNALIFIGVIVVMTFLLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  162 LYKYRCYKFIHGWLILSSLMLLFMFTYIYLSEVFKTYNIAMDYPTLFMVIWNFGAVGMICIHWKGPLQLQQAYLIMISAL 241
Cdd:pfam01080  81 LYKYRCYKFIKGWLILSSLLLLFLFSGLYLGELLKAYNIPMDYITFAFILWNFGVVGMIAIFWKGPLLLQQAYLIFISAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  242 MALVFIKYLPEWSAWVILGAISVYDLLAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMMW---TVGMADSATADGRMN 318
Cdd:pfam01080 161 MALVFIKYLPEWTTWVLLVAISIWDLFAVLCPKGPLRLLVETAQERNEPIFPALIYSATPVWlyaGVGMADERTDRETVK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  319 QQVQHIDRNTP----------------------------------EGANSTVEDAAETRIQTQSNLSSED---------- 354
Cdd:pfam01080 241 ETISNYSGNEEgedefptssgssrqainpdsdvetspprlssqrsDEASSPSSSSAEEPSEPSELSSSQDssteepeeed 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  355 ----PDEERGVKLGLGDFIFYSVLVGKAAATasGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFS 430
Cdd:pfam01080 321 agssEEEERGVKLGLGDFIFYSVLVGKAAMY--GDWNTVIACYVAILIGLCLTLLLLAIFRKALPALPISIAFGLIFYFL 398

                  ....*....
gi 148229671  431 TDNIVRPFM 439
Cdd:pfam01080 399 TRLLVEPFV 407
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
85-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 279427  Cd Length: 407  Bit Score: 567.22  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   85 KYGARHVIMLFVPVTLCMVVVVATIKSVSFYT--EKDGQ-LIYTPFSEDTTSVGERLLNSVLNTLIMISVILVMTIFLVL 161
Cdd:pfam01080   1 KYGAKQVIRLFVPVSLCMLLVVATIRSLSFYSsqVNSGAsLVYTPFHSSSDSTGTKLWGSLLNALIFIGVIVVMTFLLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  162 LYKYRCYKFIHGWLILSSLMLLFMFTYIYLSEVFKTYNIAMDYPTLFMVIWNFGAVGMICIHWKGPLQLQQAYLIMISAL 241
Cdd:pfam01080  81 LYKYRCYKFIKGWLILSSLLLLFLFSGLYLGELLKAYNIPMDYITFAFILWNFGVVGMIAIFWKGPLLLQQAYLIFISAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  242 MALVFIKYLPEWSAWVILGAISVYDLLAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMMW---TVGMADSATADGRMN 318
Cdd:pfam01080 161 MALVFIKYLPEWTTWVLLVAISIWDLFAVLCPKGPLRLLVETAQERNEPIFPALIYSATPVWlyaGVGMADERTDRETVK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  319 QQVQHIDRNTP----------------------------------EGANSTVEDAAETRIQTQSNLSSED---------- 354
Cdd:pfam01080 241 ETISNYSGNEEgedefptssgssrqainpdsdvetspprlssqrsDEASSPSSSSAEEPSEPSELSSSQDssteepeeed 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  355 ----PDEERGVKLGLGDFIFYSVLVGKAAATasGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFS 430
Cdd:pfam01080 321 agssEEEERGVKLGLGDFIFYSVLVGKAAMY--GDWNTVIACYVAILIGLCLTLLLLAIFRKALPALPISIAFGLIFYFL 398

                  ....*....
gi 148229671  431 TDNIVRPFM 439
Cdd:pfam01080 399 TRLLVEPFV 407
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
139-435 1.63e-79

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 249.09  E-value: 1.63e-79
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   139 LNSVLNTLIMISVILVMTIFLVLLYKYRCYKFIHGWLILSSLMLLFMFTYIYLSEVFKtyniaMDYPTLFMVIWNFGAVG 218
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   219 MICIHWKgpLQLQQAYLIMISALMALVFIKYLP-EWSAWVILGAISVYDLLAVLCPKGPLRMLVETAQERNEPI--FPAL 295
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   296 IYSSAMMWtvgmadsatadgrmnqqvqhidrntpeganstvedaaetriqtqsnlSSEDPDEERGVKLGLGDFIFYSVLV 375
Cdd:smart00730 154 LYVPRLVV-----------------------------------------------SFEDDEEERFSMLGLGDIVFPGILV 186
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148229671   376 GKAAATAS---GDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNIV 435
Cdd:smart00730 187 ASAARFDVsvrSDSNYFLACFVAYGIGLILTLVLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Name Accession Description Interval E-value
Presenilin pfam01080
Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It ...
85-439 0e+00

Presenilin; Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.


Pssm-ID: 279427  Cd Length: 407  Bit Score: 567.22  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   85 KYGARHVIMLFVPVTLCMVVVVATIKSVSFYT--EKDGQ-LIYTPFSEDTTSVGERLLNSVLNTLIMISVILVMTIFLVL 161
Cdd:pfam01080   1 KYGAKQVIRLFVPVSLCMLLVVATIRSLSFYSsqVNSGAsLVYTPFHSSSDSTGTKLWGSLLNALIFIGVIVVMTFLLVL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  162 LYKYRCYKFIHGWLILSSLMLLFMFTYIYLSEVFKTYNIAMDYPTLFMVIWNFGAVGMICIHWKGPLQLQQAYLIMISAL 241
Cdd:pfam01080  81 LYKYRCYKFIKGWLILSSLLLLFLFSGLYLGELLKAYNIPMDYITFAFILWNFGVVGMIAIFWKGPLLLQQAYLIFISAL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  242 MALVFIKYLPEWSAWVILGAISVYDLLAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMMW---TVGMADSATADGRMN 318
Cdd:pfam01080 161 MALVFIKYLPEWTTWVLLVAISIWDLFAVLCPKGPLRLLVETAQERNEPIFPALIYSATPVWlyaGVGMADERTDRETVK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  319 QQVQHIDRNTP----------------------------------EGANSTVEDAAETRIQTQSNLSSED---------- 354
Cdd:pfam01080 241 ETISNYSGNEEgedefptssgssrqainpdsdvetspprlssqrsDEASSPSSSSAEEPSEPSELSSSQDssteepeeed 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671  355 ----PDEERGVKLGLGDFIFYSVLVGKAAATasGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFS 430
Cdd:pfam01080 321 agssEEEERGVKLGLGDFIFYSVLVGKAAMY--GDWNTVIACYVAILIGLCLTLLLLAIFRKALPALPISIAFGLIFYFL 398

                  ....*....
gi 148229671  431 TDNIVRPFM 439
Cdd:pfam01080 399 TRLLVEPFV 407
PSN smart00730
Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic ...
139-435 1.63e-79

Presenilin, signal peptide peptidase, family; Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.


Pssm-ID: 214793  Cd Length: 249  Bit Score: 249.09  E-value: 1.63e-79
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   139 LNSVLNTLIMISVILVMTIFLVLLYKYRCYKFIHGWLILSSLMLLFMFTYIYLSEVFKtyniaMDYPTLFMVIWNFGAVG 218
Cdd:smart00730   1 EYSLLNSLVAIVFPIVATFVLVLLYKFFKYLVIVLVIYFSSLGVLFLYSLLYPLEVFR-----VDYPTLLILLLNFAVVG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   219 MICIHWKgpLQLQQAYLIMISALMALVFIKYLP-EWSAWVILGAISVYDLLAVLCPKGPLRMLVETAQERNEPI--FPAL 295
Cdd:smart00730  76 FWCIHRK--GAWIQQDLIGISLCMAILFILRLPsEWTAWILLGALFIYDIFAVFGTPGPLRVMVEVATGRDEPIkvFPAL 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148229671   296 IYSSAMMWtvgmadsatadgrmnqqvqhidrntpeganstvedaaetriqtqsnlSSEDPDEERGVKLGLGDFIFYSVLV 375
Cdd:smart00730 154 LYVPRLVV-----------------------------------------------SFEDDEEERFSMLGLGDIVFPGILV 186
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 148229671   376 GKAAATAS---GDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNIV 435
Cdd:smart00730 187 ASAARFDVsvrSDSNYFLACFVAYGIGLILTLVLLALFKKAQPALPYLVPFTLVFYLLTALLR 249
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH