NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148228890|ref|NP_001088085|]
View 

uncharacterized protein LOC494782 [Xenopus laevis]

Protein Classification

7tmA_ACKR4_CCR11 domain-containing protein (domain architecture ID 11606909)

7tmA_ACKR4_CCR11 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
44-319 5.86e-175

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


:

Pssm-ID: 320304  Cd Length: 276  Bit Score: 491.57  E-value: 5.86e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15176    1 LFLPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWAADAVNGWVLGTAMCKITSALYTM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQTTV 203
Cdd:cd15176   81 NFSCGMQFLACISVDRYVAITKATSRQFTGKHCWIVCLCVWLLAILLSIPDLVFSTVRENSDRYRCLPVFPPSLVTSAKA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 LIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSCSMS 283
Cdd:cd15176  161 TIQILEVLLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDVIYLLITDCSMS 240
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 284 RTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15176  241 KTLDIAIQVTESIALFHSCLNPVLYVFMGASFKSHI 276
 
Name Accession Description Interval E-value
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
44-319 5.86e-175

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320304  Cd Length: 276  Bit Score: 491.57  E-value: 5.86e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15176    1 LFLPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWAADAVNGWVLGTAMCKITSALYTM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQTTV 203
Cdd:cd15176   81 NFSCGMQFLACISVDRYVAITKATSRQFTGKHCWIVCLCVWLLAILLSIPDLVFSTVRENSDRYRCLPVFPPSLVTSAKA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 LIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSCSMS 283
Cdd:cd15176  161 TIQILEVLLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDVIYLLITDCSMS 240
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 284 RTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15176  241 KTLDIAIQVTESIALFHSCLNPVLYVFMGASFKSHI 276
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
60-308 3.03e-63

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 205.23  E-value: 3.03e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890   60 GNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLL-LFTLPFWATDAAVG-WQFGIFMCKITSALYTINFSSGMQFLACISL 137
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYALFGtWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  138 DRYFAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEH--NNKHACLPVYPKDKVKqttVLIQILEIVFCFL 215
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIpsNGVTSCLITFPESLWP---VSYLLFSTVVGFL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  216 LPFLVMVFCYASMAKIVLKTP------NIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIyaLITSCSMSRTIDIM 289
Cdd:pfam00001 158 LPLLVILVCYTRIIRTLRKQArsrrrsVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDL--LIIISCVVTPPRTL 235
                         250
                  ....*....|....*....
gi 148228890  290 IQVTESLALFHCCLNPVLY 308
Cdd:pfam00001 236 LQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
7-321 7.84e-45

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 159.17  E-value: 7.84e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890   7 TTIRATTENYDEYGDTTFDYGNYEElCEKKEVRQFAQIFLPAFYAVAFVIGVAGNSLVVAIYSYYKkMKSKTDVYLLNLA 86
Cdd:PHA03087   5 LTINTTIENTTDYYYDTYYDEDYAD-CDLNIGYDTNSTILIVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  87 VADLLLLFTLPFWATDA-AVGWQFGIFMCKITSALYTINFSSGMQFLACISLDRYFAVTKAPSAQPVG--KMGRVICLFV 163
Cdd:PHA03087  83 VSDLLFVMTLPFQIYYYiLFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINtvKYGYIVSLVI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 164 WSTSMLLSIPDLYFSTVKEHNNKHACLPVYpKDKVKQTTVLIQILEIVFCFLLPFLVMVFCYASMAkIVLKTPNI--KRS 241
Cdd:PHA03087 163 WIISIIETTPILFVYTTKKDHETLICCMFY-NNKTMNWKLFINFEINIIGMLIPLTILLYCYSKIL-ITLKGINKskKNK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 242 RSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYaLITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYISK 321
Cdd:PHA03087 241 KAIKLVLIIVILFVIFWLPFNVSVFVYSLHILH-FKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKK 319
 
Name Accession Description Interval E-value
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
44-319 5.86e-175

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320304  Cd Length: 276  Bit Score: 491.57  E-value: 5.86e-175
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15176    1 LFLPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWAADAVNGWVLGTAMCKITSALYTM 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQTTV 203
Cdd:cd15176   81 NFSCGMQFLACISVDRYVAITKATSRQFTGKHCWIVCLCVWLLAILLSIPDLVFSTVRENSDRYRCLPVFPPSLVTSAKA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 LIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSCSMS 283
Cdd:cd15176  161 TIQILEVLLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDVIYLLITDCSMS 240
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 284 RTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15176  241 KTLDIAIQVTESIALFHSCLNPVLYVFMGASFKSHI 276
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
44-319 1.34e-119

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320115  Cd Length: 278  Bit Score: 350.75  E-value: 1.34e-119
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd14984    1 VFLPVLYSLVFVLGLVGNSLVLLVLLYYKKLRSMTDVYLLNLALSDLLFVLTLPFWAVYAAHGWVFGSFLCKLVSALYTI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQT 201
Cdd:cd14984   81 NFYSGILFLACISIDRYLAIVHAVSALRARTLlhGKLTCLAVWALALLLSLPEFIFSQVYEENGSSRCSYIYPEDTATTW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSCS 281
Cdd:cd14984  161 KTLLRLLQNILGFLLPLLVMLFCYSRIIRTLLRARNHKKHRALRLIFAVVVVFFLCWLPYNIVLLLDTLQRLGVIIRSCE 240
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd14984  241 LSKRLDYALQVTETLAFSHCCLNPVLYAFVGEKFRKYL 278
7tmA_CCR9 cd15174
CC chemokine receptor type 9, member of the class A family of seven-transmembrane G ...
45-316 9.05e-91

CC chemokine receptor type 9, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR9 is a homeostatic receptor specific for CCL25 (formerly known as thymus expressed chemokine) and is highly expressed on both immature and mature thymocytes as well as on intestinal homing T Lymphocytes and mucosal Lymphocytes. In cutaneous melanoma, activation of CCR9-CCL25 has been shown to stimulate metastasis to the small intestine. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320302  Cd Length: 280  Bit Score: 277.02  E-value: 9.05e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTIN 124
Cdd:cd15174    2 FLPPLYWLIFLVGAVGNSLVVLIYTYYRRRKTMTDVYLLNLAIADLLFLCTLPFWATAASSGWVFGTFLCKVVNSMYKIN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 125 FSSGMQFLACISLDRYFAVTKAPSAQPVGK----MGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQ 200
Cdd:cd15174   82 FYSCMLLLTCISVDRYIAIVQATKAHNSKNkrllYSKLVCFFVWLLSTILSLPEILFSQSKEEESVTTCTMVYPSNESNR 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 201 TTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSC 280
Cdd:cd15174  162 FKVAVLALKVTVGFFLPFVVMVICYTLIIHTLLQAKRFQKHKALKVIIAVVTVFVLSQLPYNSILLIKTINAYNITITDC 241
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 281 SMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15174  242 ATSQNLDIAGQVTQSIAFLHSCLNPFLYVFVGVRFR 277
7tmA_CCR7 cd15175
CC chemokine receptor type 7, member of the class A family of seven-transmembrane G ...
45-316 1.91e-85

CC chemokine receptor type 7, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR7 is a major homeostatic receptor responsible for lymph node development and effective adaptive immune responses and plays a critical role in trafficking of dendritic cells and B and T lymphocytes. Its only two ligands, CCL and CCl21, are primarily produced by stromal cells in the T cell zones of lymph nodes and spleen. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320303  Cd Length: 278  Bit Score: 263.55  E-value: 1.91e-85
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTIN 124
Cdd:cd15175    2 FLPAMYSVICFLGLLGNGLVILTYIYFKRLKTMTDIYLLNLALADILFLLTLPFWAASAAKKWVFGEEMCKAVYCLYKMS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 125 FSSGMQFLACISLDRYFAVTKAPSAQ----PVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVypKDKVKQ 200
Cdd:cd15175   82 FFSGMLLLMCISIDRYFAIVQAASAHrhrsRAVFISKVSSLGVWVLAFILSIPELLYSGVNNNDGNGTCSIF--TNNKQT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 201 TTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSC 280
Cdd:cd15175  160 LSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQARNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFKNNTTDC 239
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 281 SMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15175  240 DYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKFR 275
7tmA_CCR10 cd15177
CC chemokine receptor type 10, member of the class A family of seven-transmembrane G ...
44-316 2.36e-84

CC chemokine receptor type 10, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR10 is a homeostatic receptor specific for two C-C motif chemokines, CCL27 and CCL28. Activation of CCR10 by its two ligands mediates diverse activities, ranging from leukocyte trafficking to skin cancer. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320305  Cd Length: 280  Bit Score: 260.47  E-value: 2.36e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMK-SKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYT 122
Cdd:cd15177    1 TFQPCVFLVVFVLGVVGNGLVLATFTAYRRLRlSMTDVFLLHLALADLLLLLTLPFQAADTLQGWIFGNAMCKLIQGLYA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 123 INFSSGMQFLACISLDRYFAVTKAPSAQPVGK----MGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKV 198
Cdd:cd15177   81 INFYSGLLFLACISVDRYLVIVRATVAHRLRPktlrYSVLTALIVWLVSILLSLPQLLFSRVENRSELSSCRMIFPESLT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 199 KQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIyALIT 278
Cdd:cd15177  161 QTAKKATALAQVVLGFCIPFLVMAVCYALIGRTLLAARGWERHRALKVMLALVVLFVLFQLPYSVVLLLDTADLL-ATRR 239
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 279 SCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15177  240 SCSQSKRKDLAELVTSGLAYVRCCLNPLLYAFVGVRFR 277
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
44-316 2.16e-75

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320306  Cd Length: 279  Bit Score: 237.56  E-value: 2.16e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15178    1 LALCVIYVLVFLLSLPGNSLVVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSVVKGWIFGTFMCKLVSLLQEA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKM-GRVICLFVWSTSMLLSIPDLYFSTVK--EHNNKHACLPVYPKDKVKQ 200
Cdd:cd15178   81 NFYSGILLLACISVDRYLAIVHATRALTQKRHlVKFVCAGVWLLSLLLSLPALLNRDAFkpPNSGRTVCYENLGNESADK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 201 TTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFwraIDIIY---ALI 277
Cdd:cd15178  161 WRVVLRILRHTLGFLLPLVVMLFCYGFTIKTLLQTRSFQKHRAMRVIFAVVLAFLLCWLPYNVTVL---IDTLMrtkLIT 237
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 148228890 278 TSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15178  238 ETCELRNHVDVALYVTQILGFLHSCINPVLYAFIGQKFR 276
7tmA_CCR6 cd15172
CC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
44-318 2.96e-75

CC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR6 is the only known receptor identified for the chemokine CCL20 (also known as macrophage inflammatory protein-3alpha, MIP-3alpha). CCR6 is expressed by all mature human B cells, effector memory T-cells, and dendritic cells found in the gut mucosal immune system. CCL20 contributes to recruitment of CCR6-expressing cells to Peyer's patches and isolated lymphoid follicles in the intestine, thereby promoting the assembly and maintenance of organized lymphoid structures. Also, CCL20 expression is highly inducible in response to inflammatory signals. Thus, CCL20 is involved in both inflammatory and homeostatic functions in the immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320300  Cd Length: 281  Bit Score: 237.34  E-value: 2.96e-75
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15172    1 VFVPVIYSLICVVGLIGNSLVVITYAFYKRTKSMTDVYLLNMAIADILFVLTLPFWAVYEAHQWIFGNFSCKLLRGIYAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSA----QPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEH--NNKHACLPVYPKDK 197
Cdd:cd15172   81 NFYSGMLLLACISVDRYIAIVQATKSfrlrSRTLAYSKLICAAVWLLAILISLPTFIFSEVYDFmtNEQYVCEPKYPKNS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 198 V-KQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYAL 276
Cdd:cd15172  161 TaIMWKLLVLSLQVSLGFFIPLLVMIFCYSFIIKTLLQAQNSQRHKAVRVVVAVVLVFLVCQVPYNIVLLIEAINLGENQ 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 148228890 277 itSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCY 318
Cdd:cd15172  241 --SCSSEKAVAYAKTITECLAFFHCCLNPVLYAFIGVKFRNY 280
7tmA_CXCR6 cd15173
CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
44-319 6.79e-74

CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR6 binds specifically to the chemokine CXCL16, which is expressed on dendritic cells, monocyte/macrophages, activated T cells, fibroblastic reticular cells, and cancer cells. CXCR6 is phylogenetically more closely related to CC-type chemokine receptors (CCR6 and CCR9) than other CXC receptors. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320301  Cd Length: 270  Bit Score: 233.51  E-value: 6.79e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15173    1 YFLPCMYSVMFVTGLVGNSLVIVIYIFYEKLRTLTDIFLVNLAVADLLFLCTLPFWAYSAAHEWIFGTVMCKITNGLYTI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSA--QPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHaCLPVYPKDKVK 199
Cdd:cd15173   81 NLYSSMLILTCITVDRFIVIVQATKAhnCHAKKMrwGKVVCTLVWVISLLLSLPQFIYSEVRNLSSKI-CSMVYPPDAIE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 qttVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITS 279
Cdd:cd15173  160 ---VVVNIIQMTVGFFLPLLAMIICYSVIIKTLLHAKGFQKHKSLKIIFVVVAVFILTQLPYNIMKLIRTLHIENTDSTN 236
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 148228890 280 csmsrtIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15173  237 ------FKYAILITEAIAYLHACLNPILYAFVGVKFRKNF 270
7tmA_CXCR4 cd15179
CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G ...
44-318 2.10e-72

CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR4 is the only known G protein-coupled chemokine receptor for the key homeostatic ligand CXCL12, which is constitutively secreted by bone marrow stromal cells. Atypical chemokine receptor CXCR7 (ACKR3) also binds CXCL12, but activates signaling in a G protein-independent manner. CXCR4 is also a co-receptor for HIV infection and plays critical roles in the development of immune system during both lymphopoiesis and myelopoiesis. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320307  Cd Length: 278  Bit Score: 229.65  E-value: 2.10e-72
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15179    1 IFLPTVYSIIFLLGIVGNGLVILVMGYQKKSRTMTDKYRLHLSVADLLFVLTLPFWAVDAAANWYFGNFLCKAVHVIYTV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQT 201
Cdd:cd15179   81 NLYSSVLILAFISLDRYLAIVHATNSQRPRKLlaEKVVYVGVWLPALLLTVPDLVFAKVSELDGRYICDRIYPEDTFELW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITSCS 281
Cdd:cd15179  161 LVAFRFQHILVGLVLPGLVILTCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGILIDTFMLLEVIKHSCE 240
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCY 318
Cdd:cd15179  241 MEQTVHKWISITEALAFFHCCLNPILYAFLGAKFKTS 277
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
44-316 5.90e-69

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320308  Cd Length: 280  Bit Score: 220.72  E-value: 5.90e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15180    1 VFLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVHGWIFGTGLCKLAGAVFKI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVI--CLFVWSTSMLLSIPDLYFSTVK--EHNNKHACLPVYPKDKVK 199
Cdd:cd15180   81 NFYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLVHlsCLIVWLFCLLLSIPDFIFLEATkdPRQNKTECVHNFPQSTTD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLIQILEIVfCFLLPFLVMVFCYAS-MAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALIT 278
Cdd:cd15180  161 WWLALRLLYHIV-GFLLPLAVMVYCYTSiLLRLLRSSQGFQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLSVLDR 239
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 279 SCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15180  240 NCGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFR 277
7tmA_ACKR2_D6 cd15188
atypical chemokine receptor 2, member of the class A family of seven-transmembrane G ...
44-319 2.75e-65

atypical chemokine receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR2 (also known as D6) binds non-selectively to all inflammatory CC-chemokines, but not to homeostatic CC-chemokines involved in controlling the migration of cells. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320316  Cd Length: 278  Bit Score: 211.18  E-value: 2.75e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIY-SYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYT 122
Cdd:cd15188    1 VFLPVFYTLVFLLGLAGNLLLFVVLlLYVPKKKKMTEVYLLNLAVSDLLFLVTLPFWAMYVAWHWVFGSFLCKFVSTLYT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 123 INFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVICL--FVWSTSMLLSIPDLYFSTVKE-HNNKHACLPVYPKDKVK 199
Cdd:cd15188   81 INFYSGIFFVSCMSLDKYLEIVHAQSPHRLRTRRKSLLVlvAVWVLSIALSVPDMVFVQTHHtNNGVWVCHADYGGHHTI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QtTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYaLITS 279
Cdd:cd15188  161 W-KLVFQFQQNLLGFLFPLLAMVFFYSRIACVLTRLRPPGQGRALRFVAALVVVFFVLWFPYNLTLFLHSLQDLH-VIGN 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 148228890 280 CSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15188  239 CERSRHLDYALQVTESLAFVHCCLNPLLYAFVSKRFRLYL 278
7tmA_CXCR5 cd15181
CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G ...
44-316 4.38e-65

CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR5 is a B-cell selective receptor that binds specifically to the homeostatic chemokine CXCL13 and regulates adaptive immunity. The receptor is found on all peripheral blood and tonsillar B cells and is involved in lymphocyte migration (homing) to specific tissues and development of normal lymphoid tissue. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320309  Cd Length: 281  Bit Score: 210.76  E-value: 4.38e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15181    1 VFIPLAYSLVFLLGVVGNGLVLTILLRRRRSRRTTENYLLHLALADLLLLLTFPFSVVESIAGWVFGTFLCKLVGAIHKL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRV--ICLFVWSTSMLLSIPDLYFSTVKE--HNNKHAClpVYPKDKVK 199
Cdd:cd15181   81 NFYCSSLLLACISVDRYLAIVHAIHSYRHRRLRSVhlTCGSIWLVCFLLSLPNLVFLEVETstNANRTSC--SFHQYGIH 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLI--QILEIVFCFLLPFLVMVFCYASMAKIVLKTP-NIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYAL 276
Cdd:cd15181  159 ESNWWLtsRFLYHVVGFFLPLLIMGYCYATIVVTLCQSSrRLQKQKAIRVAILVTLVFCLCWLPYNIVIFLDTLDDLKAV 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 148228890 277 ITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15181  239 VKNCKLNDLLDAAITVTESLGFSHCCLNPILYAFIGVKFR 278
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
60-308 3.03e-63

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431  Cd Length: 254  Bit Score: 205.23  E-value: 3.03e-63
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890   60 GNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLL-LFTLPFWATDAAVG-WQFGIFMCKITSALYTINFSSGMQFLACISL 137
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYALFGtWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  138 DRYFAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEH--NNKHACLPVYPKDKVKqttVLIQILEIVFCFL 215
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIpsNGVTSCLITFPESLWP---VSYLLFSTVVGFL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  216 LPFLVMVFCYASMAKIVLKTP------NIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIyaLITSCSMSRTIDIM 289
Cdd:pfam00001 158 LPLLVILVCYTRIIRTLRKQArsrrrsVRSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDL--LIIISCVVTPPRTL 235
                         250
                  ....*....|....*....
gi 148228890  290 IQVTESLALFHCCLNPVLY 308
Cdd:pfam00001 236 LQLTVWLAYSNSCLNPIIY 254
7tmA_CX3CR1 cd15186
CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G ...
44-319 5.88e-59

CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CX3CR1 is an inflammatory receptor specific for CX3CL1 (also known as fractalkine in human), which is involved in the adhesion and migration of leukocytes. The CX3C chemokine subfamily is only represented by CX3CL1, which exists in both soluble and membrane-anchored forms. Membrane-anchored form promotes strong adhesion of receptor-bearing leukocytes to CX3CL1-expressing endothelial cells. On the other hand, soluble CX3CL1, which is released by the proteolytic cleavage of membrane-anchored CX3CL1, is a potent chemoattractant for CX3CR1-expressing T cells and monocytes. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320314  Cd Length: 273  Bit Score: 194.67  E-value: 5.88e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15186    1 IFLSIFYSLVFAFGLVGNLLVVLALTNSGKSKSITDIYLLNLALSDLLFVATLPFWTHYLINEWGLHNAMCKLTTAFFFI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSA--QPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNnkhaCLPVYPKDKVKQT 201
Cdd:cd15186   81 GFFGGIFFITVISIDRYLAIVLAANSmnNRTVQHGVTISLGVWAAAILVAVPQFMFTKMKENE----CLGDYPEVLQEIW 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDiIYALITSCS 281
Cdd:cd15186  157 PVLRNVELNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKARAIKLILLVVIVFFLFWTPYNVMIFLETLK-LYDFFPSCD 235
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15186  236 MKKDLRLALSVTETIAFSHCCLNPLIYAFAGEKFRRYL 273
7tmA_CCR5_CCR2 cd15184
CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G ...
45-319 7.97e-59

CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR2 and CCR5 share very high amino acid sequence identity. Both receptors play important roles in the trafficking of monocytes/macrophages and are implicated in the pathogenesis of immunologic diseases (rheumatoid arthritis, celiac disease, and transplant rejection) and cardiovascular diseases (atherosclerosis and autoimmune hepatitis). CCR2 is a receptor specific for members of the monocyte chemotactic protein family, including CCL2, CCL7, and CCL13. Conversely, CCR5 is a major co-receptor for HIV infection and binds many CC chemokine ligands, including CC chemokine ligands including CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL14, and CCL16. CCR2 is expressed primarily on blood monocytes and memory T cells, whereas CCR5 is expressed on antigen-presenting cells (macrophages and dendritic cells) and activated T effector cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320312  Cd Length: 278  Bit Score: 194.60  E-value: 7.97e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTIN 124
Cdd:cd15184    2 LLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAAHEWIFGNAMCKLLTGLYHIG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 125 FSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQTT 202
Cdd:cd15184   82 FFSGIFFIILLTIDRYLAIVHAVFALKARTVtfGVVTSVVTWVVAVFASLPGIIFTRSQKEGSHYTCSPHFPPSQYQFWK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 203 VLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPN-IKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALiTSCS 281
Cdd:cd15184  162 NFQTLKMNILGLVLPLLVMIICYSGILKTLLRCRNeKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGL-NNCS 240
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15184  241 SSNRLDQAMQVTETLGMTHCCINPVIYAFVGEKFRSYL 278
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
44-319 1.98e-57

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315  Cd Length: 276  Bit Score: 190.78  E-value: 1.98e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15187    1 LFLPVLYCLLFVFGLLGNSLVIWVLVACKKLRSMTDVYLLNLAASDLLFVFSLPFQAYYLLDQWVFGNAMCKIVSGAYYI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPV--GKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQt 201
Cdd:cd15187   81 GFYSSMFFITLMSIDRYLAIVHAVYALKVrtASHGTILSLALWLVAILASVPLLVFYQVASEDGRLQCIPFYPGQGNSW- 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYaLITSCS 281
Cdd:cd15187  160 KVFTNFEVNILGLLIPFSILIFCYHNILRNLRRCHNQNKTKAIKLVFIVVIVFFLFWTPFNVVLFLDSLHSLH-IIDGCQ 238
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15187  239 NSQRLTLALHLTETISFTHCCLNPVIYAFVGEKFKKHL 276
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
44-316 4.30e-55

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 320116  Cd Length: 284  Bit Score: 184.90  E-value: 4.30e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd14985    1 VVIPAFYIAIFLVGLLGNLFVVWLFLLPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANQydWPFGDFLCKVSSYAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPV--GKMGRVICLFVWSTSMLLSIPDLYFSTVK--EHNNKHACLPVYPKDK 197
Cdd:cd14985   81 TVNMFASVFLLTCMSVDRYLAIVHPVASRRLrrRRQARVTCALIWVVACLLSLPTFLLRSLQalPDLNKTACIELYPHEA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 198 VKqttVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTP------NIKRSRSLKVLLAVVGVFLVTQLPYNVIKFwraID 271
Cdd:cd14985  161 WH---VGLSLVLNILGFVLPLVIILTCYCHIARTLRTHYertgkgGRKRRKSLKIIFAVVVAFLVCWLPFHVFKF---LD 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 148228890 272 IIYAL--ITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14985  235 FLAQLgaIRPCFWEAFLDLGLPIATCLAFTNSCLNPFIYVFFDRRFR 281
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
44-316 4.76e-55

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotatctin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320310  Cd Length: 271  Bit Score: 184.49  E-value: 4.76e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTI 123
Cdd:cd15182    1 AFLPVFYYLVFLLSLLGNGLVLWILVKYEKLKTLTNIFILNLAISDLLFTFTLPFWASYHSSGWIFGEILCKAVTSIFYI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHN-NKHACLPVYPKDKvkq 200
Cdd:cd15182   81 GFYSSILFLTLMTIDRYLAVVHPLSALRSRKLryASLVSVAVWVISILASLPELILSTVMKSDeDGSLCEYSSIWWK--- 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 201 ttvLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYalITSC 280
Cdd:cd15182  158 ---LGYYYQQNLFFLIPLGIIVYCYVRILQTLMRTRTMRKHRTVKLIFVIVLVFFLSWAPYNIVIFLRSLKDLT--IPIC 232
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 281 SMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15182  233 ECSKQLDYAFYICRNIAFSHCCLNPVFYVFVGVKFR 268
7tmA_CCR3 cd15185
CC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
45-319 1.36e-54

CC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR3 is a highly promiscuous receptor that binds a variety of inflammatory CC-type chemokines, including CCL11 (eotaxin-1), CCL3L1, CCL5 (regulated on activation, normal T cell expressed and secreted; RANTES), CCL7 (monocyte-specific chemokine 3 or MCP-3), CCL8 (MCP-2), CCL11, CCL13 (MCP-4), CCL15, CCL24 (eotaxin-2), CCL26 (eotaxin-3), and CCL28. Among these, the eosinophil chemotactic chemokines (CCL11, CCL24, and CCL26) are the most potent and specific ligands. In addition to eosinophil, CCR3 is expressed on cells involved in allergic responses, such as basophils, Th2 lymphocytes, and mast cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320313  Cd Length: 278  Bit Score: 183.49  E-value: 1.36e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG-WQFGIFMCKITSALYTI 123
Cdd:cd15185    2 FLPPLYSLVFIVGLLGNVVVVVILIKYRKLRIMTNIYLLNLAISDLLFLFTLPFWIHYVRWNnWVFGHGMCKLLSGFYYL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQT 201
Cdd:cd15185   82 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVtfGIITSIITWGLAVLAALPEFIFYETQELFEEFLCSPLYPEDTEDSW 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYaLITSCS 281
Cdd:cd15185  162 KRFHALRMNIFGLALPLLIMVICYTGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVLLFSAFQSIF-FETDCE 240
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15185  241 RSKHLDLAMQVTEVIAYTHCCINPVIYAFVGERFRKYL 278
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
46-319 1.65e-54

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320311  Cd Length: 278  Bit Score: 183.15  E-value: 1.65e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG-WQFGIFMCKITSALYTIN 124
Cdd:cd15183    3 LPPLYSLVFIIGVVGNVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFWIDYKLKDdWIFGDAMCKFLSGFYYLG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 125 FSSGMQFLACISLDRYFAVTKAPSA--QPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVKQTT 202
Cdd:cd15183   83 LYSEIFFIILLTIDRYLAIVHAVFAlrARTVTFGIITSIITWALAILASMPCLYFFKSQWEFTHHTCSAHFPRKSLIRWK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 203 VLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAI-DIIYAliTSCS 281
Cdd:cd15183  163 RFQALKLNLLGLILPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFqDVLFT--PSCE 240
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 148228890 282 MSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15183  241 QSQQLDLALQVTEVIAYTHCCVNPVIYVFVGERFRKYL 278
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
44-316 5.50e-52

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320113  Cd Length: 283  Bit Score: 176.69  E-value: 5.50e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd14982    1 TLFPIVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGgwWPFGDFLCRLTGLLF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVT---KAPSAQPVGKMgRVICLFVWSTSMLLSIPDL-YFSTVKEHNNKHACLPVYPKDk 197
Cdd:cd14982   81 YINMYGSILFLTCISVDRYLAVVhplKSRRLRRKRYA-VGVCAGVWILVLAASVPLLlLRSTIAKENNSTTCFEFLSEW- 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 198 vKQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPN-----IKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDI 272
Cdd:cd14982  159 -LASAAPLVLIALVVGFLIPLLIILVCYSLIIRALRRRSKqsqksVRKRKALRMILIVLAVFLVCFLPYHVTRILYLLVR 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 148228890 273 IYaLITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14982  238 LS-VIADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFR 280
7tmA_AT2R cd15191
type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
45-316 6.56e-52

type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320319  Cd Length: 286  Bit Score: 176.48  E-value: 6.56e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALYT 122
Cdd:cd15191    2 AIPVLYSIIFILGFLGNSLVVCVLCHQSGPKTVANIYILNLAVADLLFLATLPLWAVYYSLGynWLFGSVMCKICGSLLT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 123 INFSSGMQFLACISLDRYFAVTKAPSAQ--PVGKMGRVICLFVWSTSMLLSIPDLYFSTVK--EHNNKHACLPVYPKDKV 198
Cdd:cd15191   82 LNLYASIFFITCMSVDRYLAIVYPLRSQrrRSPRQARLVCLLVWVLACLSSLPTFYFRDTYyiEELGVTACIMDYPNEEY 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 199 KQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPN-----IKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDII 273
Cdd:cd15191  162 AQWSAGLALMKNTLGFLLPLIVIATCYCGIGRHLLATKGfglnkQRRDKVLKLVAAVVLAFLICWFPFHVLTFLDALARM 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 148228890 274 yALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15191  242 -GVINNCWVITVIDKALPFAICLGFSNSCINPFLYCFVGNHFR 283
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
44-318 1.20e-51

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320  Cd Length: 285  Bit Score: 176.08  E-value: 1.20e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15192    1 IMIPTVYSIIFVIGIFGNSLVVIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGyhWPFGNFLCKISSTLV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTV--KEHNNKHACLPVYPKDK 197
Cdd:cd15192   81 SFNLYASVFLLTCLSIDRYLAIVHPMKSRIRRTLvvARVTCIVIWLLAGVASLPAIIFRDVffYENWNKTVCAFHYPNQN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 198 vKQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRS-----LKVLLAVVGVFLVTQLPYNVIKFwraIDI 272
Cdd:cd15192  161 -KQLLVGMGLMKNLLGFLIPFLIILTCYTLIGKTLKQAYQIQRSKSrndeiFKMIMAVVLFFFFCWIPHQVFTF---LDV 236
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 148228890 273 IYAL--ITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCY 318
Cdd:cd15192  237 LIQLkvIQNCHILEIVDTAMPFTICIAYFNSCLNPILYGFVGKNFRKK 284
7tmA_ACKR3_CXCR7 cd14987
CXC chemokine receptor 7, member of the class A family of seven-transmembrane G ...
46-316 2.44e-49

CXC chemokine receptor 7, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR3, also known as CXCR7, is an atypical chemokine receptor for CXCL12 and CXCR11. Unlike the classical chemokine receptors, ACKR3 contains a DRYLSIT-sequence instead of the conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. Thus, ACKR3 does not activate classical GPCR signaling, instead induces beta-arrestin recruitment which is leading to ligand internalization and MAP-kinase activation. It is acting as a scavenger for CXCL12 and, to a lesser degree, for CXCL11. ACKR3 is highly expressed by blood vascular endothelial cells in brain, in numerous embryonic and neonatal tissues, in inflamed tissues and in a variety of cancers such as lymphomas, sarcomas, prostate and breast cancers, and gliomas. Five receptors have been identified for the ACKR family, including CC-Chemokine Receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, DARC, and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320118  Cd Length: 282  Bit Score: 169.55  E-value: 2.44e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAV--GWQFGIFMCKITSALYTI 123
Cdd:cd14987    3 LSFFYIFIFVIGLLANSVVVWVNLQAKRTGYETHLYILNLAIADLCVVATLPVWVVSLVQhnQWPMGEFTCKITHLIFSI 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVT--KAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYF-STVKE-HNNKHACLPVYPKDKVK 199
Cdd:cd14987   83 NLFGSIFFLTCMSVDRYLSVTlfGNTSSRRKKIVRRIICVLVWLLAFVASLPDTYFlKTVTSpSNNETYCRSFYPEESFK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALITS 279
Cdd:cd14987  163 EWLIGMELVSIVLGFVIPFPIIAVFYFLLARAISASSDQERKSSRKIIFSYVVVFLVCWLPYHTVVLLDILSFLHLIPFS 242
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 148228890 280 CSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14987  243 CQLENFLYAALHVTQCFSLVHCCVNPILYSFINRNYR 279
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
48-311 1.38e-48

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320086  Cd Length: 274  Bit Score: 167.45  E-value: 1.38e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  48 AFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLL-LLFTLPFWATDAAVG-WQFGIFMCKITSALYTINF 125
Cdd:cd00637    3 VLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLvGLLVIPFSLVSLLLGgWWFGDALCKLLGFLQTVSL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 126 SSGMQFLACISLDRYFAVTKAPSAQPVGKMGRV--ICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDkvkQTTV 203
Cdd:cd00637   83 TASILTLTAISVDRYLAIVHPLRYRRRFTKRRAklVIALIWLLSLLLALPPLLGWKVYEYGGYCCCCLCWPDL---TLSK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 LIQILEIVFCFLLPFLVMVFCYASMAKIVLKT--------------PNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRA 269
Cdd:cd00637  160 AYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHrkrissssnssrrrRRRRERKVTKMLLIVVVVFLLCWLPYFILFLLDV 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 148228890 270 IDIIYalitscsmSRTIDIMIQVTESLALFHCCLNPVLYAFM 311
Cdd:cd00637  240 FGPDP--------SPLPRILYFLALLLAYLNSAINPIIYAFF 273
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
44-316 4.14e-48

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321  Cd Length: 279  Bit Score: 166.47  E-value: 4.14e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15193    1 IYIPILYLIIFFTGLLGNLFVIALMSKRSTTKRLVDTFVLNLAVADLVFVLTLPFWAASTALGgqWLFGEGLCKLSSFII 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPVG--KMGRVICLFVWSTSMLLSIPDLYFSTVKEHNnkhaclpVYPKDKVK 199
Cdd:cd15193   81 AVNRCSSILFLTGMSVDRYLAVVKLLDSRPLRtrRCALITCCIIWAVSLVLGIPSLVYRNLINES-------VCVEDSSS 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNI------KRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDII 273
Cdd:cd15193  154 RFFQGISLATLFLTFVLPLIVILFCYCSILVRLRRHFHGakrtgrRRRNSLRIVFAIVTAFVLSWLPFNTLKAVRLLLEL 233
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 148228890 274 YALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15193  234 GGGVLPCHTTVAIRQGLTITACLAFVNSCVNPLIYSLLDRHFR 276
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
44-316 4.71e-46

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105  Cd Length: 274  Bit Score: 160.93  E-value: 4.71e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYyKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd14974    1 IVSLVLYALIFLLGLPGNGLVIWVAGF-KMKRTVNTVWFLNLALADFLFCLFLPFLIVYIAMGhhWPFGSVLCKLNSFVI 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVtkapsAQPV-------GKMGRVICLFVWSTSMLLSIPDLYF-STVKEHNNKHACLPVY 193
Cdd:cd14974   80 SLNMFASVFLLTAISLDRCLLV-----LHPVwaqnhrtVRLASVVCVGIWILALVLSVPYFVFrDTVTHHNGRSCNLTCV 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 194 PKDKVKQTT-VLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRaidi 272
Cdd:cd14974  155 EDYDLRRSRhKALTVIRFLCGFLLPLLIIAICYSVIAVKLRRKRLAKSSKPLRVLLAVVVAFFLCWLPYHVFALLE---- 230
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 148228890 273 iyaLITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14974  231 ---LVAAAGLPEVVLLGLPLATGLAYFNSCLNPILYVFMGQDFR 271
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
44-316 6.49e-45

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101  Cd Length: 282  Bit Score: 157.84  E-value: 6.49e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG-WQFGIFMCKITSALYT 122
Cdd:cd14970    1 IVIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGLPFLATSYLLGyWPFGEVMCKIVLSVDA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 123 INFSSGMQFLACISLDRYFAVTKAPSAQPV--GKMGRVICLFVWSTSMLLSIPDLYFS-TVKEHNNKHACLPVYPKDKVK 199
Cdd:cd14970   81 YNMFTSIFCLTVMSVDRYLAVVHPVKSLRFrtPRKAKLVSLCVWALSLVLGLPVIIFArTLQEEGGTISCNLQWPDPPDY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLIqILEIVFCFLLPFLVMVFCYASMAK------IVLKTPNIKRSRSLK----VLLAVVGVFLVTQLPYNVIkfwra 269
Cdd:cd14970  161 WGRVFT-IYTFVLGFAVPLLVITVCYSLIIRrlrssrNLSTSGAREKRRARRkvtrLVLVVVAVFVVCWLPFHVF----- 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 148228890 270 idIIYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14970  235 --QIVRLLIDPPETLTVVGVFLFCIALSYANSCLNPILYAFLDENFR 279
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
7-321 7.84e-45

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976  Cd Length: 335  Bit Score: 159.17  E-value: 7.84e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890   7 TTIRATTENYDEYGDTTFDYGNYEElCEKKEVRQFAQIFLPAFYAVAFVIGVAGNSLVVAIYSYYKkMKSKTDVYLLNLA 86
Cdd:PHA03087   5 LTINTTIENTTDYYYDTYYDEDYAD-CDLNIGYDTNSTILIVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  87 VADLLLLFTLPFWATDA-AVGWQFGIFMCKITSALYTINFSSGMQFLACISLDRYFAVTKAPSAQPVG--KMGRVICLFV 163
Cdd:PHA03087  83 VSDLLFVMTLPFQIYYYiLFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINtvKYGYIVSLVI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 164 WSTSMLLSIPDLYFSTVKEHNNKHACLPVYpKDKVKQTTVLIQILEIVFCFLLPFLVMVFCYASMAkIVLKTPNI--KRS 241
Cdd:PHA03087 163 WIISIIETTPILFVYTTKKDHETLICCMFY-NNKTMNWKLFINFEINIIGMLIPLTILLYCYSKIL-ITLKGINKskKNK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 242 RSLKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYaLITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYISK 321
Cdd:PHA03087 241 KAIKLVLIIVILFVIFWLPFNVSVFVYSLHILH-FKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKK 319
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
44-317 4.41e-41

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 320296  Cd Length: 283  Bit Score: 147.85  E-value: 4.41e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15168    1 IFLPIVYGVVFLVGLLLNAVVLYRFIFSLKPWNSSAIYMFNLAVSDLLYLLSLPFLIYYYANGdhWIFGDFMCKLVRFLF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPVG--KMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACL----PVYPK 195
Cdd:cd15168   81 YFNLYCSILFLTCISVHRYLGICHPMRSLRKLkkRHAVAVCVAVWILVLLQLLPILFFATTGRPNNRTTCYdttsPEELN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 196 DKVKQTTVLIQILeivfcFLLPFLVMVFCYASMAKIVLKTPNI-----KRSRSLKVLLAVVGVFLVTQLPYNVIKFWRaI 270
Cdd:cd15168  161 DYVPYSMVLTGLG-----FLLPLLIILACYGLIARTLLRSLGSgvtsaLRRKSIRLVIVVLALFAVCFLPFHVTRTIY-L 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 148228890 271 DIIYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKC 317
Cdd:cd15168  235 AARLLSGTSCATLNGIYVAYKVTRPLASLNSCLNPLLYFLTGDKFRR 281
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
46-312 1.17e-39

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 320095  Cd Length: 270  Bit Score: 143.70  E-value: 1.17e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLL-LLFTLPFWATDAAVG-WQFGIFMCKITSALYTI 123
Cdd:cd14964    1 LFVLLLLIFLLGLLGNLLVLLVILRSRRLRTPTNLFLLNLALADLLfSLVVVPFLLLGLLSGeWSFGFAGCKLVLFFFYL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSAQ--PVGKMGRVICLFVWSTSMLLSIPDLYFSTVKeHNNKHACLPVYPKDKVKQT 201
Cdd:cd14964   81 FGFASIFLLTAMAIDRYLAICHPLKYTvlMTPRRARLLILGIWVLSLLLSLPPLLGWGTL-PFCGPNVPLLTLSCSDTAW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 202 TVLIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNI---------KRSRSLKVLLAVVGVFLVTQLPYNvikfwraidI 272
Cdd:cd14964  160 NIAYTLGLLILGFLLPLLLILVSYARIVRALLRRKRItrsaissarRERKAFKTLLIVVLVFLLCWLPYH---------I 230
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 148228890 273 IYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMG 312
Cdd:cd14964  231 VYLLPALLQLSNSLPLLLLLSVLLAVLNSCLNPLIYSLRN 270
7tmA_CCRL2 cd15171
CC chemokine receptor-like 2, member of the class A family of seven-transmembrane G ...
46-319 1.17e-39

CC chemokine receptor-like 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine (CC-motif) receptor-like 2 (CCRL2) is a member of the atypical chemokine receptor family. CCRL2, like other atypical receptors, has an alteration in the conserved DRYLAIV motif in the third intracellular loop, which is essential for GPCR coupling and signaling. CCR2L is expressed in most hematopoietic cells and many lymphoid organs as well as in heart and lung. CCRL2 was initially reported to promote chemotaxis and calcium fluxes in responses to chemokines (CCL2, CCL5, CCL7, and CCL8); however, these results are still controversial. More recently, chemerin, a chemotactic agonist of CMKLR1 (chemokine-like receptor-1) and GPR1, was identified as a novel non-signaling ligand for both human and mouse CCRL2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C).


Pssm-ID: 320299  Cd Length: 279  Bit Score: 143.82  E-value: 1.17e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQFGIFMCKITSALYTINF 125
Cdd:cd15171    3 VPQLCSAVFLVGLLDNGLVVFILVKYKGLKHVENIYFLNLAVSNLCFLLTLPFWAHAAWHGGSLGNPTCKVLVALSSVGL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 126 SSGMQFLACISLDRY---FAVTKAPSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHAC----LPVYPKDKV 198
Cdd:cd15171   83 HSEALFNVLLTVQASrvfFHGRLASSARRVAPCGIIASVLAWLTAFLVTLPEFVFYKPQMDSQKSKCafsrPHFLPAEET 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 199 KQTTVLIQILEIVfCFLLPFLVMVFCYASMAKiVLKTPNIKRSRSlKVLLAVVGVFLVTQLPYNVIKFWRAIDIIYALiT 278
Cdd:cd15171  163 FWKYFLTLKMNIV-VLVFPLLVFIICCVQLRK-TQRFRERQRDLS-KLVFAIMVVFLLMWAPYNIALFLSAFKEHFSL-R 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 148228890 279 SCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15171  239 DCKSSYHLDASVQVTKLIATTHCCVNPLLYALLDPAFRRRL 279
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
46-316 5.20e-39

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 320318  Cd Length: 292  Bit Score: 142.59  E-value: 5.20e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALYTI 123
Cdd:cd15190    3 IPVIYMLVFVLGLSGNGLVIWTVFRSKAKRRSADTFIANLALADLTFVVTLPLWAVYTALGyhWPFGSFLCKLSSYLVFV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTK--APSAQPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHACL------PVYPK 195
Cdd:cd15190   83 NMYASVFCLTCLSFDRYLAIVRslASAKLRSRTSGIVALGVIWLLAGLLALPALILRTTRELDGSNKTIcdmdfsGVVSN 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 196 DKVKQTTVLIQILEIVFCFLLPFLVMVFCYASMAKIV------LKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRA 269
Cdd:cd15190  163 EAELFWIAGLGLSSTVLGFLLPFLVMLTCYFFIGRTVarhfskERKELKKKRRLLKIIITLVVTFALCWLPFHLVKTIYA 242
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 148228890 270 IDIIYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15190  243 LMYLGILPFSCGFDQFLVNAHPYATCLAYVNSCLNPFLYAFFDPRFR 289
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
44-316 1.59e-38

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124  Cd Length: 296  Bit Score: 141.20  E-value: 1.59e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLL-LLFTLPF-WATDAAVGWQFGIFMCKITSALY 121
Cdd:cd14993    1 IVLIVLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLvSLFCMPLtLLENVYRPWVFGEVLCKAVPYLQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVT---KAPSAQPVGKMGRVIClFVWSTSMLLSIPDLYFSTVKEHNN-------KHACLP 191
Cdd:cd14993   81 GVSVSASVLTLVAISIDRYLAICyplKARRVSTKRRARIIIV-AIWVIAIIIMLPLLVVYELEEIISsepgtitIYICTE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 192 VYPKDKVKQttvLIQILEIVFCFLLPFLVMVFCYASMAK------------IVLKTPNIKRSRS----LKVLLAVVGVFL 255
Cdd:cd14993  160 DWPSPELRK---AYNVALFVVLYVLPLLIISVAYSLIGRrlwrrkppgdrgSANSTSSRRILRSkkkvARMLIVVVVLFA 236
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 148228890 256 VTQLPYNVIKFWraidIIYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14993  237 LSWLPYYVLSIL----LDFGPLSSEESDENFLLILPFAQLLGYSNSAINPIIYCFMSKKFR 293
7tmA_GPR15 cd15194
G protein-coupled receptor 15, member of the class A family of seven-transmembrane G ...
44-321 2.83e-38

G protein-coupled receptor 15, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR15, also called as Brother of Bonzo (BOB), is an orphan G-protein coupled receptor that was originally identified as a co-receptor for human immunodeficiency virus. GPR15 is upregulated in patients with rheumatoid arthritis and shares high sequence homology with angiotensin II type AT1 and AT2 receptors; however, its endogenous ligand is unknown. GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation.


Pssm-ID: 320322  Cd Length: 281  Bit Score: 140.38  E-value: 2.83e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15194    1 GFLPILYCLVFLVGAVGNAILMGALVFKRGVRRLIDIFISNLAASDFIFLVTLPLWVDKEVVLgpWRSGSFLCKGSSYII 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPVGKM--GRVICLFVWSTSMLLSIPDLYFSTVKEHNNKHAClpvyPKDKVK 199
Cdd:cd15194   81 SVNMYCSVFLLTCMSLDRYLAIVLPLVSRKFRTKhnAKVCCTCVWMLSCLLGLPTLLSRELKKYEEKEYC----NEDAGT 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTVLIQILEIVFCFLLPFLVMVFCYASMAKIVLK------TPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIDII 273
Cdd:cd15194  157 PSKVIFSLVSLIVAFFLPLLSILTCYCTIIWKLCHhyqksgKHQKKLRKSIKIVFIVVAAFVFSWMPFNLFKALAIASGL 236
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 148228890 274 YALITsCSMSRTIDIMIQVTESLALFHCCLNPVLYAFmgttFKCYISK 321
Cdd:cd15194  237 QVEVT-CLPYTLAQLGMEVSAPLAFANSCANPFIYYF----FDRYIRR 279
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
45-316 2.66e-37

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503  Cd Length: 284  Bit Score: 137.59  E-value: 2.66e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  45 FLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALYT 122
Cdd:cd15381    2 FQPIYLWIIFVLGTIENAFVLIVFCLHKSSCTVAEIYLGNLAAADLLLVCCLPFWAINISNGfnWPFGEFLCKSVNAVIY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 123 INFSSGMQFLACISLDRYFAVTKAPSaqpVGKMGRV-----ICLFVWSTSMLLSIPDLYFSTVKEHN--NKHACLPVYPK 195
Cdd:cd15381   82 MNLYSSIYFLMMVSIDRYLALVKTMS---SGRMRRPacaklNCLIIWMFGLLMSTPMIVFRTVMYFPeyNITACVLDYPS 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 196 DkvkQTTVLIQILEIVFCFLLPFLVMVFCYASMAKiVLKTPNIKR-------SRSLKVLLAVVGVFLVTQLPYNVIKFwr 268
Cdd:cd15381  159 E---GWHVALNILLNVVGFLIPLSIITFCSTQIIQ-VLRNNKMQKfkeiqteRKATVLVLAVLLMFFICWLPFHIFTF-- 232
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 148228890 269 aIDIIY--ALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15381  233 -LDTLHklGLISGCRWEDILDIGTQIATFLAYSNSCLNPLLYVIVGKHFR 281
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
46-316 6.83e-37

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 136.44  E-value: 6.83e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  46 LPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAA--VGWQFGIFMCKITSALYTI 123
Cdd:cd15189    3 IPPFIFSLCLFGLLGNLFVLLVFLLHRRRLTVAEIYLGNLAAADLVFVSGLPFWAMNILnqFNWPFGELLCRVVNGVIKV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 124 NFSSGMQFLACISLDRYFAVTKAPSA--QPVGKMGRVICLFVWSTSMLLSIPDLYFSTVKEHN--NKHACLPVYPKDKVK 199
Cdd:cd15189   83 NLYTSIYLLVMISQDRYLALVKTMAArrLRRRRYAKLICVLIWVVGLLLSIPTFLLRKIKAIPdlNITACVLLYPHEAWH 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTvliQILEIVFCFLLPFLVMVFCYASMAKiVLKT-------PNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFwraIDI 272
Cdd:cd15189  163 FAH---IVLLNIVGFLLPLLVITFCNYNILQ-ALRTreestrcEDRNDSKATALVLAVTLLFLVCWGPYHFFTF---LDF 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 148228890 273 IYAL--ITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15189  236 LFDVgvLDECFWEHFIDIGLQLAVFLAFSNSCLNPVLYVFVGRYFR 281
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
44-316 9.65e-37

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287  Cd Length: 286  Bit Score: 135.94  E-value: 9.65e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15159    1 VLLPLFYSLILVFGLLGNTLALHVICQKRKKINSTTLYLINLAVSDILFTLALPGRIAYYALGfdWPFGDWLCRLTALLF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQPVGKMGRV--ICLFVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVK 199
Cdd:cd15159   81 YINTYAGVNFMTCLSVDRYIAVVHPLRRHRLRKVKVVryICVFVWVLVFLQTLPLLFMPMTKEMGGRITCMEYPNFEKIK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 200 QTTvLIQILEIVFCFLLPFLVMVFCYasmAKIVLKTPNIKRSRSLK-----------VLLAVVGVFLVTQLPYNVIKFWR 268
Cdd:cd15159  161 RLP-LILLGACVIGFGVPVGIILFCY---SQITLKLCRTAKENPLTeksghhkkacnVILLVLLVFVVCFSPYHLNIIQF 236
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 148228890 269 AIDIIYALiTSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15159  237 MIRKLLYQ-PSCSELKAFKISLQITVCLMNLNCCLDPFIYFFACKGYK 283
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
29-316 2.22e-36

chemokine receptor-like protein; Provisional


Pssm-ID: 165177  Cd Length: 323  Bit Score: 136.19  E-value: 2.22e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  29 YEELCEKKEVRQFAQIFLPAFYAVAFVIGVAGNSLVVAIYsYYKKMKSKTDVYLLNLAVADLLLLFTLPFWATDAAVGWQ 108
Cdd:PHA02834  14 FEEECDFEMVNSDVNYFVIVFYILLFIFGLIGNVLVIAVL-IVKRFMFVVDVYLFNIAMSDLMLVFSFPFIIHNDLNEWI 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 109 FGIFMCKITSALYTINFSSGMQFLACISLDRYFAVTKAPSAQPVG-KMGRVICLFVWSTSMLLSIPDLYFSTVKEHNNKH 187
Cdd:PHA02834  93 FGEFMCKLVLGVYFVGFFSNMFFVTLISIDRYILVVNATKIKNKSiSLSVLLSVAAWVCSVILSMPAMVLYYVDNTDNLK 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 188 ACLPVYPKDKVKQTTVLIQILEIvFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFW 267
Cdd:PHA02834 173 QCIFNDYHENFSWSAFFNFEINI-FGIVIPLIILIYCYSKILYTLKNCKNKNKTRSIKIILTVVTFTVVFWVPFNIVLFI 251
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 148228890 268 RAIDIIYALITSCSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:PHA02834 252 NSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFK 300
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
48-316 4.28e-36

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098  Cd Length: 259  Bit Score: 133.46  E-value: 4.28e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  48 AFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLL-LFTLPFWATDAAVG-WQFGIFMCKITSALYTINF 125
Cdd:cd14967    4 VFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVaLLVMPFSAVYTLLGyWPFGPVLCRFWIALDVLCC 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 126 SSGMQFLACISLDRYFAVTKAPSAQPVGKMGRVICL--FVWSTSMLLSIPDLYFSTVKEHNNKHACLPVYPKDKVkqttv 203
Cdd:cd14967   84 TASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMiaAVWVYSLLISLPPLVGWRDETQPSVVDCECEFTPNKI----- 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 lIQILEIVFCFLLPFLVMVFCYASMAKIVLktpniKRSRSLKVLLAVVGVFLVTQLPYNVIKFWRAIdiiyalitsCSMS 283
Cdd:cd14967  159 -YVLVSSVISFFIPLLIMIVLYARIFRVAR-----RELKAAKTLAIIVGAFLLCWLPFFIIYLVSAF---------CPPD 223
                        250       260       270
                 ....*....|....*....|....*....|...
gi 148228890 284 RTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd14967  224 CVPPILYAVFFWLGYLNSALNPIIYALFNRDFR 256
7tmA_C5aR cd15114
complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of ...
50-316 5.51e-36

complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320242  Cd Length: 274  Bit Score: 133.68  E-value: 5.51e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  50 YAVAFVIGVAGNSLVVAIYSYYKKmKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALYTINFSS 127
Cdd:cd15114    7 YAVVFLVGVPGNALVAWVTGFEAK-RSVNAVWFLNLAVADLLCCLSLPILAVPIAQDghWPFGAAACKLLPSLILLNMYA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 128 GMQFLACISLDRYFAVTKAPSAQPVGK--MGRVICLFVWSTSMLLSIPDLYFSTVKEHN--NKHACLPVYPKDkvKQTTV 203
Cdd:cd15114   86 SVLLLTAISADRCLLVLRPVWCQNHRRarLAWIACGAAWLLALLLTVPSFIYRRIHQEHfpEKTVCVVDYGGS--TGVEW 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 204 LIQILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVikfwraIDIIYAliTSCSMS 283
Cdd:cd15114  164 AVAIIRFLLGFLGPLVVIASCHGVLLVRTWSRRRQKSRRTLKVVTAVVVGFFLCWTPYHV------VGLIIA--ASAPNS 235
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 148228890 284 RTIDIMIQV---TESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15114  236 RLLANALKAdplTVSLAYINSCLNPIIYVVAGRGFR 271
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
47-319 5.99e-36

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223  Cd Length: 288  Bit Score: 133.95  E-value: 5.99e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  47 PAFYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADL-LLLFTLPFWATDAAV-GWQFGIFMCKITSALYTIN 124
Cdd:cd15095    4 PLIFAIIFLVGLAGNSLVIYVVSRHREMRTVTNYYIVNLAVTDLaFLVCCVPFTAALYATpSWVFGDFMCKFVNYMMQVT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 125 FSSGMQFLACISLDRYFAVTkapsaQPVGKMGR-------VICLFVWSTSMLLSIPDLYFSTVKEHN---NKHACLPVYP 194
Cdd:cd15095   84 VQATCLTLTALSVDRYYAIV-----HPIRSLRFrtprvavVVSACIWIVSFLLSIPVAIYYRLEEGYwygPQTYCREVWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 195 KDKVKQTTVLIQILeivFCFLLPFLVMVFCYASMAKIVLKT--------------PNIKRSRSLKVLLAVVGVFLVTQLP 260
Cdd:cd15095  159 SKAFQKAYMIYTVL---LTYVIPLAIIAVCYGLILRRLWRRsvdgnnqseqlserALRQKRKVTRMVIVVVVLFAICWLP 235
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 148228890 261 YNVIKFWRAIDI-------IYALITSCSMsrtidimiqvtesLALFHCCLNPVLYAFMGTTFKCYI 319
Cdd:cd15095  236 NHVLNLWQRFDPnfpetyaTYALKIAALC-------------LSYANSAVNPFVYAFMGENFRKYF 288
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
44-316 7.52e-36

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226  Cd Length: 282  Bit Score: 133.70  E-value: 7.52e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKMK--SKTDVYLLNLAVADLL-LLFTLPFWATDAAV-GWQFGIFMCKITSA 119
Cdd:cd15098    1 VIVPVVFGLIFCLGVLGNSLVITVLARVKPGKrrSTTNVFILNLSIADLFfLLFCVPFQATIYSLpEWVFGAFMCKFVHY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 120 LYTINFSSGMQFLACISLDRYFAVTKAPSAQP--VGKMGRVICLFVWSTSMLLSIPDLYFSTVKEH---NNKHACLPVYP 194
Cdd:cd15098   81 FFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSlrTRRNALLGVLVIWVLSLAMASPVAVHQDLVHHwtaSNQTFCWENWP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 195 KDKVKQTTVLIQileIVFCFLLPFLVMVFCYASM-------AKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFW 267
Cdd:cd15098  161 EKQQKPVYVVCT---FVFGYLLPLLLITFCYAKVlnhlhkkLKNMSKKSERSKKKTAQTVLVVVVVFGISWLPHHIIHLW 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 148228890 268 raidIIYALITSCSMSRTIDImiqVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15098  238 ----VEFGDFPLTQASFVLRI---TAHCLAYANSCVNPIIYAFLSENFR 279
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
44-316 9.54e-36

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244  Cd Length: 284  Bit Score: 133.35  E-value: 9.54e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  44 IFLPAFYAVAFVIGVAGNSLVVAIYSYYKKmKSKTDVYLLNLAVADLLLLFTLPFWATDAAVG--WQFGIFMCKITSALY 121
Cdd:cd15116    1 ILSMVIYSVVFVLGVLGNGLVIFITGFKMK-KTVNTVWFLNLAVADFLFTFFLPFSIAYTAMDfhWPFGRFMCKLNSFLL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 122 TINFSSGMQFLACISLDRYFAVTKAPSAQP--VGKMGRVICLFVWSTSMLLSIPDLYF--STVKEHNNKHACLPVYPKDK 197
Cdd:cd15116   80 FLNMFTSVFLLTVISIDRCISVVFPVWSQNhrSVRLASLVSLAVWVVAFFLSSPSFIFrdTAPSQNNNKIICFNNFSLSG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 198 VKQTTVLIQ----------ILEIVFCFLLPFLVMVFCYASMAKIVLKTPNIKRSRSLKVLLAVVGVFLVTQLPYNVIKFW 267
Cdd:cd15116  160 DNSSPEVNQlrnmrhqvmtITRFLLGFLIPFTIIICCYAAIVLKLKRNRLAKSSKPFKIIAAVIVTFFLCWAPYHILNLL 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 148228890 268 RAIDIIyalitscSMSRTIDIMIQVTESLALFHCCLNPVLYAFMGTTFK 316
Cdd:cd15116  240 EMEATR-------SPASVFKIGLPITSSLAFINSCLNPILYVFMGQDFK 281
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
49-316 1.25e-35

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132  Cd Length: 266  Bit Score: 132.40  E-value: 1.25e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890  49 FYAVAFVIGVAGNSLVVAIYSYYKKMKSKTDVYLLNLAVADLLLL-FTLPF-WATDAAVGWQFGIFMCKITSALYTINFS 126
Cdd:cd15001    5 VYVITFVLGLIGNSLVIFVVARFRRMRSVTNVFLASLATADLLLLvFCVPLkTAEYFSPTWSLGAFLCKAVAYLQLLSFI 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148228890 127 SGMQFLACISLDRYFAVT---KAPSAQPVG