NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147904503|ref|NP_001079908|]
View 

cysteine rich angiogenic inducer 61 S homeolog precursor [Xenopus laevis]

Protein Classification

IGFBP and VWC domain-containing protein (domain architecture ID 10446263)

protein containing domains IGFBP, VWC, TSP1, and GHB_like

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GHB_like super family cl21545
Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the ...
289-371 7.08e-13

Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the beta chains of gonadotropins, thyrotropins, follitropins, choriogonadotropins and more. The members are reproductive hormones that consist of two glycosylated chains (alpha and beta), which form a tightly bound dimer.


The actual alignment was detected with superfamily member pfam00007:

Pssm-ID: 328788  Cd Length: 105  Bit Score: 65.12  E-value: 7.08e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147904503  289 APVRYTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRCNyN 353
Cdd:pfam00007   9 YTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG-N 87
                          90
                  ....*....|....*...
gi 147904503  354 CPHTNEAYPYYRLFNDIH 371
Cdd:pfam00007  88 CPTDNSDCTRLSLQPDSC 105
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 7.13e-10

Insulin-like growth factor binding protein;


:

Pssm-ID: 306685  Cd Length: 53  Bit Score: 55.39  E-value: 7.13e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 147904503   26 CPAVC---QCPVEVPKCAPGvgLVLDGCGCCKICAKQLNEDCS-KTHPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAG--LVLDGCGCCPVCARQEGEPCGvYTPPCD--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 2.95e-08

von Willebrand factor (vWF) type C domain;


:

Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.98  E-value: 2.95e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 147904503   100 CEYNSKIYQNGESFQPNCKHQCTCIDGA-VGCLPL-CPqelslPNLGCPNPRLVKVPGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
227-267 2.13e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 36.80  E-value: 2.13e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 147904503   227 QTTSWSQCSKTCGTGISTRV--------TNDNSNCR-LVRETRICEVRPC 267
Cdd:smart00209   3 EWSEWSPCSVTCGGGVQTRTrsccspppQNGGGPCTgEDVETRACNEQPC 52
 
Name Accession Description Interval E-value
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
289-371 7.08e-13

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerisation.


Pssm-ID: 109076  Cd Length: 105  Bit Score: 65.12  E-value: 7.08e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147904503  289 APVRYTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRCNyN 353
Cdd:pfam00007   9 YTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG-N 87
                          90
                  ....*....|....*...
gi 147904503  354 CPHTNEAYPYYRLFNDIH 371
Cdd:pfam00007  88 CPTDNSDCTRLSLQPDSC 105
CT smart00041
C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta ...
287-355 8.61e-12

C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.


Pssm-ID: 214482  Cd Length: 82  Bit Score: 61.65  E-value: 8.61e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147904503   287 SQAPVRYTYAGCSSVKkYRPKYC-GSCVD------------GRCCTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRCNYN 353
Cdd:smart00041   2 SPVRQTITYNGCTSVT-VKNAFCeGKCGSassysiqdvqhsCSCCQPHKTKTRQVRLRCPDGSTVKKTVMHIEECGCEPN 80

                   ..
gi 147904503   354 CP 355
Cdd:smart00041  81 CP 82
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 7.13e-10

Insulin-like growth factor binding protein;


Pssm-ID: 306685  Cd Length: 53  Bit Score: 55.39  E-value: 7.13e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 147904503   26 CPAVC---QCPVEVPKCAPGvgLVLDGCGCCKICAKQLNEDCS-KTHPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAG--LVLDGCGCCPVCARQEGEPCGvYTPPCD--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 2.95e-08

von Willebrand factor (vWF) type C domain;


Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.98  E-value: 2.95e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 147904503   100 CEYNSKIYQNGESFQPNCKHQCTCIDGA-VGCLPL-CPqelslPNLGCPNPRLVKVPGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
VWC pfam00093
von Willebrand factor type C domain; The high cutoff was used to prevent overlap with ...
100-160 1.46e-07

von Willebrand factor type C domain; The high cutoff was used to prevent overlap with pfam00094.


Pssm-ID: 278520  Cd Length: 57  Bit Score: 48.96  E-value: 1.46e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 147904503  100 CEYNSKIYQNGESFQPNCKHQCTCIDGAVGCLPlcpqeLSLPNLGCPNPRLVKVPGQCCEE 160
Cdd:pfam00093   1 CVQNGVVYENGETWKPDLCTICTCDDGKVLCDK-----IICPPLDCPNPRLEIPPGECCPV 56
IB smart00121
Insulin growth factor-binding protein homologues; High affinity binding partners of ...
26-86 8.21e-07

Insulin growth factor-binding protein homologues; High affinity binding partners of insulin-like growth factors.


Pssm-ID: 197525  Cd Length: 75  Bit Score: 47.08  E-value: 8.21e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 147904503    26 CPAVC--QCPVEVPKCApgVGLVLDGCGCCKICAKQLNEDCSK-THPCdhTKGLECNFGASSRA 86
Cdd:smart00121   3 CPPCDpaRCPPCPPGCA--ELVRLDGCGCCPVCARQEGEPCGVyTPRC--APGLRCQPPPGEER 62
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
227-267 2.13e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 36.80  E-value: 2.13e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 147904503   227 QTTSWSQCSKTCGTGISTRV--------TNDNSNCR-LVRETRICEVRPC 267
Cdd:smart00209   3 EWSEWSPCSVTCGGGVQTRTrsccspppQNGGGPCTgEDVETRACNEQPC 52
 
Name Accession Description Interval E-value
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
289-371 7.08e-13

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerisation.


Pssm-ID: 109076  Cd Length: 105  Bit Score: 65.12  E-value: 7.08e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147904503  289 APVRYTYAGCSSVKKYRPKYC-GSCV-------DGR-------CCTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRCNyN 353
Cdd:pfam00007   9 YTISVEKEGCTSCKTINTTICaGYCYtrdpvykDGRravsqrvCTYRDVTYETVVLPGCPPGVDPTVTYPVALSCHCG-N 87
                          90
                  ....*....|....*...
gi 147904503  354 CPHTNEAYPYYRLFNDIH 371
Cdd:pfam00007  88 CPTDNSDCTRLSLQPDSC 105
CT smart00041
C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta ...
287-355 8.61e-12

C-terminal cystine knot-like domain (CTCK); The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.


Pssm-ID: 214482  Cd Length: 82  Bit Score: 61.65  E-value: 8.61e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147904503   287 SQAPVRYTYAGCSSVKkYRPKYC-GSCVD------------GRCCTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRCNYN 353
Cdd:smart00041   2 SPVRQTITYNGCTSVT-VKNAFCeGKCGSassysiqdvqhsCSCCQPHKTKTRQVRLRCPDGSTVKKTVMHIEECGCEPN 80

                   ..
gi 147904503   354 CP 355
Cdd:smart00041  81 CP 82
IGFBP pfam00219
Insulin-like growth factor binding protein;
26-78 7.13e-10

Insulin-like growth factor binding protein;


Pssm-ID: 306685  Cd Length: 53  Bit Score: 55.39  E-value: 7.13e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 147904503   26 CPAVC---QCPVEVPKCAPGvgLVLDGCGCCKICAKQLNEDCS-KTHPCDhtKGLEC 78
Cdd:pfam00219   1 CPPPCdpeRCPPPPPGCPAG--LVLDGCGCCPVCARQEGEPCGvYTPPCD--KGLRC 53
VWC smart00214
von Willebrand factor (vWF) type C domain;
100-159 2.95e-08

von Willebrand factor (vWF) type C domain;


Pssm-ID: 214564  Cd Length: 59  Bit Score: 50.98  E-value: 2.95e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 147904503   100 CEYNSKIYQNGESFQPNCKHQCTCIDGA-VGCLPL-CPqelslPNLGCPNPRLVKVPGQCCE 159
Cdd:smart00214   1 CVHNGRVYNDGETWKPDPCQICTCLDGTtVLCDPVeCP-----PPPDCPNPERVKPPGECCP 57
VWC pfam00093
von Willebrand factor type C domain; The high cutoff was used to prevent overlap with ...
100-160 1.46e-07

von Willebrand factor type C domain; The high cutoff was used to prevent overlap with pfam00094.


Pssm-ID: 278520  Cd Length: 57  Bit Score: 48.96  E-value: 1.46e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 147904503  100 CEYNSKIYQNGESFQPNCKHQCTCIDGAVGCLPlcpqeLSLPNLGCPNPRLVKVPGQCCEE 160
Cdd:pfam00093   1 CVQNGVVYENGETWKPDLCTICTCDDGKVLCDK-----IICPPLDCPNPRLEIPPGECCPV 56
IB smart00121
Insulin growth factor-binding protein homologues; High affinity binding partners of ...
26-86 8.21e-07

Insulin growth factor-binding protein homologues; High affinity binding partners of insulin-like growth factors.


Pssm-ID: 197525  Cd Length: 75  Bit Score: 47.08  E-value: 8.21e-07
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 147904503    26 CPAVC--QCPVEVPKCApgVGLVLDGCGCCKICAKQLNEDCSK-THPCdhTKGLECNFGASSRA 86
Cdd:smart00121   3 CPPCDpaRCPPCPPGCA--ELVRLDGCGCCPVCARQEGEPCGVyTPRC--APGLRCQPPPGEER 62
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
227-267 2.13e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 36.80  E-value: 2.13e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 147904503   227 QTTSWSQCSKTCGTGISTRV--------TNDNSNCR-LVRETRICEVRPC 267
Cdd:smart00209   3 EWSEWSPCSVTCGGGVQTRTrsccspppQNGGGPCTgEDVETRACNEQPC 52
Sclerostin pfam05463
Sclerostin (SOST); This family contains several mammalian sclerostin (SOST) proteins. SOST is ...
318-350 6.90e-03

Sclerostin (SOST); This family contains several mammalian sclerostin (SOST) proteins. SOST is thought to suppress bone formation. Mutations of the SOST gene lead to sclerosteosis, a progressive sclerosing bone dysplasia with an autosomal recessive mode of inheritance. Radiologically, it is characterized by a generalized hyperostosis and sclerosis leading to a markedly thickened and sclerotic skull, with mandible, ribs, clavicles and all long bones also being affected. Due to narrowing of the foramina of the cranial nerves, facial nerve palsy, hearing loss and atrophy of the optic nerves can occur. Sclerosteosis is clinically and radiologically very similar to van Buchem disease, mainly differentiated by hand malformations and a large stature in sclerosteosis patients.


Pssm-ID: 253205  Cd Length: 198  Bit Score: 37.20  E-value: 6.90e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 147904503  318 CTPQQTRTVKIRFRCEDGETFTKNVMMIQSCRC 350
Cdd:pfam05463 123 CVNDRTRTQRIQLQCQDGTTRTYKVTVVTSCKC 155
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH