NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147903565|ref|NP_001087351|]
View 

MGC85536 protein [Xenopus laevis]

Protein Classification

H2A domain-containing protein (domain architecture ID 10049432)

H2A domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
8-122 1.70e-58

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


:

Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 178.68  E-value: 1.70e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   8 KDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTShGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL 87
Cdd:cd00074    1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHL 79
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 147903565  88 QLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:cd00074   80 QLAVRNDEELNKLLKgVTIASGGVLPNIHKVLLPKK 115
 
Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
8-122 1.70e-58

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 178.68  E-value: 1.70e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   8 KDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTShGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL 87
Cdd:cd00074    1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHL 79
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 147903565  88 QLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:cd00074   80 QLAVRNDEELNKLLKgVTIASGGVLPNIHKVLLPKK 115
PLN00155 PLN00155
histone H2A; Provisional
1-62 1.17e-11

histone H2A; Provisional


Pssm-ID: 165723  Cd Length: 58  Bit Score: 55.87  E-value: 1.17e-11
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 147903565   1 MAGGKAGKDSGKakaKAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYL 62
Cdd:PLN00155   1 MAGRGKGKTSGK---KAVSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYL 58
Histone_H2A_C pfam16211
C-terminus of histone H2A;
95-127 7.94e-10

C-terminus of histone H2A;


Pssm-ID: 292828  Cd Length: 34  Bit Score: 50.52  E-value: 7.94e-10
                          10        20        30
                  ....*....|....*....|....*....|....
gi 147903565   95 EELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKT 127
Cdd:pfam16211   1 EELNKLLGgVTIAQGGVLPNIHAVLLPKKTKKKK 34
PLN00154 PLN00154
histone H2A; Provisional
6-121 5.62e-62

histone H2A; Provisional


Pssm-ID: 177756 [Multi-domain]  Cd Length: 136  Bit Score: 188.61  E-value: 5.62e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   6 AGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR 85
Cdd:PLN00154  17 AAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPR 96
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 147903565  86 HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
Cdd:PLN00154  97 HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132
H2A smart00414
Histone 2A;
19-124 5.58e-57

Histone 2A;


Pssm-ID: 197711 [Multi-domain]  Cd Length: 106  Bit Score: 174.83  E-value: 5.58e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565    19 SRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD 98
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 147903565    99 SLIKA-TIAGGGVIPHIHKSLIGKKGQ 124
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
1-122 4.90e-43

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587 [Multi-domain]  Cd Length: 132  Bit Score: 140.00  E-value: 4.90e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   1 MAGGKAGKDSGKAKAKavSRSQRAGLQFPVGRIHRHLKtRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:COG5262    2 VSGGKGGKAADARVSQ--SRSAKAGLIFPVGRVKRLLK-KGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKK 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 147903565  81 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:COG5262   79 RIIPRHLQLAIRNDEELNKLLGdVTIAQGGVLPNINPGLLPKS 121
Histone pfam00125
Core histone H2A/H2B/H3/H4;
5-94 3.16e-17

Core histone H2A/H2B/H3/H4;


Pssm-ID: 278551 [Multi-domain]  Cd Length: 127  Bit Score: 72.45  E-value: 3.16e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565    5 KAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 84
Cdd:pfam00125  38 RPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSKTDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITP 117
                          90
                  ....*....|
gi 147903565   85 RHLQLAIRGD 94
Cdd:pfam00125 118 KDIQLARRLR 127
 
Name Accession Description Interval E-value
H2A cd00074
Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two ...
8-122 1.70e-58

Histone 2A; H2A is a subunit of the nucleosome. The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins.


Pssm-ID: 238029 [Multi-domain]  Cd Length: 115  Bit Score: 178.68  E-value: 1.70e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   8 KDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTShGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL 87
Cdd:cd00074    1 KGGGKKKSKKRSRSARAGLQFPVGRIHRYLKKGRYA-ERVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKKRITPRHL 79
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 147903565  88 QLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:cd00074   80 QLAVRNDEELNKLLKgVTIASGGVLPNIHKVLLPKK 115
PLN00155 PLN00155
histone H2A; Provisional
1-62 1.17e-11

histone H2A; Provisional


Pssm-ID: 165723  Cd Length: 58  Bit Score: 55.87  E-value: 1.17e-11
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 147903565   1 MAGGKAGKDSGKakaKAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYL 62
Cdd:PLN00155   1 MAGRGKGKTSGK---KAVSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYL 58
Histone_H2A_C pfam16211
C-terminus of histone H2A;
95-127 7.94e-10

C-terminus of histone H2A;


Pssm-ID: 292828  Cd Length: 34  Bit Score: 50.52  E-value: 7.94e-10
                          10        20        30
                  ....*....|....*....|....*....|....
gi 147903565   95 EELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKT 127
Cdd:pfam16211   1 EELNKLLGgVTIAQGGVLPNIHAVLLPKKTKKKK 34
PLN00154 PLN00154
histone H2A; Provisional
6-121 5.62e-62

histone H2A; Provisional


Pssm-ID: 177756 [Multi-domain]  Cd Length: 136  Bit Score: 188.61  E-value: 5.62e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   6 AGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR 85
Cdd:PLN00154  17 AAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPR 96
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 147903565  86 HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
Cdd:PLN00154  97 HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132
PTZ00017 PTZ00017
histone H2A; Provisional
3-128 1.71e-60

histone H2A; Provisional


Pssm-ID: 185399 [Multi-domain]  Cd Length: 134  Bit Score: 184.56  E-value: 1.71e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   3 GGKAGKDSGK-AKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKR 81
Cdd:PTZ00017   2 GGKGKTGGGKaGKKKPVSRSAKAGLQFPVGRVHRYLKKGRYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAAKDNKKKR 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 147903565  82 ITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKKGQQKTA 128
Cdd:PTZ00017  81 ITPRHIQLAIRNDEELNKLLaGVTIASGGVLPNIHKVLLPKKSKPKQG 128
H2A smart00414
Histone 2A;
19-124 5.58e-57

Histone 2A;


Pssm-ID: 197711 [Multi-domain]  Cd Length: 106  Bit Score: 174.83  E-value: 5.58e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565    19 SRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD 98
Cdd:smart00414   1 SRSARAGLQFPVGRIHRLLRKGTYAK-RVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKRRITPRHLQLAIRNDEELN 79
                           90       100
                   ....*....|....*....|....*..
gi 147903565    99 SLIKA-TIAGGGVIPHIHKSLIGKKGQ 124
Cdd:smart00414  80 KLLKGvTIAQGGVLPNIHKVLLPKKTG 106
HTA1 COG5262
Histone H2A [Chromatin structure and dynamics];
1-122 4.90e-43

Histone H2A [Chromatin structure and dynamics];


Pssm-ID: 227587 [Multi-domain]  Cd Length: 132  Bit Score: 140.00  E-value: 4.90e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   1 MAGGKAGKDSGKAKAKavSRSQRAGLQFPVGRIHRHLKtRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:COG5262    2 VSGGKGGKAADARVSQ--SRSAKAGLIFPVGRVKRLLK-KGNYRMRIGAGAPVYLAAVLEYLAAEILELAGNAARDNKKK 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 147903565  81 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 122
Cdd:COG5262   79 RIIPRHLQLAIRNDEELNKLLGdVTIAQGGVLPNINPGLLPKS 121
PLN00157 PLN00157
histone H2A; Provisional
3-128 9.20e-41

histone H2A; Provisional


Pssm-ID: 177758 [Multi-domain]  Cd Length: 132  Bit Score: 134.21  E-value: 9.20e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   3 GGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRI 82
Cdd:PLN00157   2 SGRGKRKGGGGGKKATSRSAKAGLQFPVGRIARYLKAGKYAT-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRI 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 147903565  83 TPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKTA 128
Cdd:PLN00157  81 VPRHIQLAVRNDEELSKLLGgVTIAAGGVLPNIHSVLLPKKSGKSKG 127
PLN00156 PLN00156
histone H2AX; Provisional
1-125 1.17e-38

histone H2AX; Provisional


Pssm-ID: 215080 [Multi-domain]  Cd Length: 139  Bit Score: 128.93  E-value: 1.17e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   1 MAGGKAGKDSGKAKA-KAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV 79
Cdd:PLN00156   2 AGSGTTKGGRGKPKAtKSVSRSSKAGLQFPVGRIARFLKAGKYAE-RVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKK 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 147903565  80 KRITPRHLQLAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKKGQQ 125
Cdd:PLN00156  81 NRIVPRHIQLAVRNDEELSKLLGSvTIAAGGVLPNIHQTLLPKKVGK 127
PLN00153 PLN00153
histone H2A; Provisional
1-122 6.76e-34

histone H2A; Provisional


Pssm-ID: 165721 [Multi-domain]  Cd Length: 129  Bit Score: 116.36  E-value: 6.76e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565   1 MAGGKAGKDSGKakaKAVSRSQRAGLQFPVGRIHRHLKTRTTSHgRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 80
Cdd:PLN00153   1 MAGRGKGKTSGK---KAVSRSAKAGLQFPVGRIARYLKKGKYAE-RIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 147903565  81 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 122
Cdd:PLN00153  77 RIVPRHIQLAIRNDEELGKLLgEVTIASGGVLPNIHAVLLPKK 119
PTZ00252 PTZ00252
histone H2A; Provisional
12-128 3.06e-21

histone H2A; Provisional


Pssm-ID: 240330 [Multi-domain]  Cd Length: 134  Bit Score: 83.47  E-value: 3.06e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565  12 KAKAKAVSRSQRAGLQFPVGRIHRHLKtRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS--KDLKVKRITPRHLQL 89
Cdd:PTZ00252  10 KASKSGSGRSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAAaqQAKKPKRLTPRTVTL 88
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 147903565  90 AIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKTA 128
Cdd:PTZ00252  89 AVRHDDDLGSLLKnVTLSRGGVMPSLNKALAKKHKSGKKA 128
Histone pfam00125
Core histone H2A/H2B/H3/H4;
5-94 3.16e-17

Core histone H2A/H2B/H3/H4;


Pssm-ID: 278551 [Multi-domain]  Cd Length: 127  Bit Score: 72.45  E-value: 3.16e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147903565    5 KAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 84
Cdd:pfam00125  38 RPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSKTDLRISADAVVALQEALEDYLVELFEDANLLAKHAKRVTITP 117
                          90
                  ....*....|
gi 147903565   85 RHLQLAIRGD 94
Cdd:pfam00125 118 KDIQLARRLR 127
BUR6 COG5247
Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];
27-100 6.67e-06

Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription];


Pssm-ID: 227572 [Multi-domain]  Cd Length: 113  Bit Score: 40.72  E-value: 6.67e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 147903565  27 QFPVGRIHRHLKTrTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL 100
Cdd:COG5247   23 RFPIARLKKIMQL-DEDIGKVGQSTPVIASKALEMFLTEIVGLSLKEARKKSSKRMTSEFLKRATESDEKFDFL 95
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH