NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147899864|ref|NP_001081438|]
View 

patched 2 S homeolog [Xenopus laevis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Patched super family cl25655
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
26-1172 0e+00

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


The actual alignment was detected with superfamily member TIGR00918:

Pssm-ID: 330476  Cd Length: 1145  Bit Score: 1829.89  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864    26 APSSDLLRRPSYCHAAFALKQIAKGKAVGQKAPLWLRAQFQALLFSLGCSIQRHCGKVLFIGLLVFGALAVGLRVASIET 105
Cdd:TIGR00918    4 APDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIET 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   106 DIERLWVEAGSRVSHELRYTKEKLGEESVYTSQMLIQTPKREGENILTHEALLLHLRAALAASKVQVSMYGKSWDLNKIC 185
Cdd:TIGR00918   84 NVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLC 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   186 YKSGVPIIENGMIERMIEKLFPCVIITPLDCFWEGSQLQGGSAYLPGRADIQWTNLDPIRLMEELGQFTS-LDGFKEMLD 264
Cdd:TIGR00918  164 YKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSqVESWEEMLK 243
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   265 KAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRGGCYGFSKKFMYWQKELILGGMLKGPNGELKSAEALQTM 344
Cdd:TIGR00918  244 KAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSM 323
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   345 YLLMSPGQLFEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQAQQSVPQNSSQDIHAFSTTTLNDIMKSFSDVSAIRVA 424
Cdd:TIGR00918  324 FQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIV 403
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   425 GGYLLMLAYACVTLLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFT 504
Cdd:TIGR00918  404 SGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFS 483
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   505 ETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRRED 584
Cdd:TIGR00918  484 ETGQNIPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRRED 563
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   585 QRLDILCCFYSPCSSRVIQIQPQEFSDandnhtyhpssyGNPTITTSTQITTTVQAFTQCDPSGHHIVTILPPTSQISTS 664
Cdd:TIGR00918  564 RRLDIFCCFFSPCSARVIQIEPQAYAD------------GSAPPVYSSHMQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQ 631
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   665 PSvivptmDPLGSQIFTPSSSTRDLLAQLDESKEKreCVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVTLFMALLGLG 744
Cdd:TIGR00918  632 PS------DPLSCQSPDIAGSTRDLLSQFEDSKAA--CLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLS 703
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   745 LYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKM 824
Cdd:TIGR00918  704 LYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGNFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRM 783
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   825 WLHYFQDWLRGLQTSFDMDWESGYITQDSYRNGTEDGVLAYKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYL 904
Cdd:TIGR00918  784 WLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYL 863
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   905 TVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTGENLRIPATEPIEFAQFPFYLNGLRQTSDFVEAIESVRSVCEEFVKQ 984
Cdd:TIGR00918  864 SAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPENLRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGF 943
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   985 GVHSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVV 1064
Cdd:TIGR00918  944 GLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVV 1023
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1065 ILIASVGIGVEFTVHVALGFLTAIGDRNQRSVLALEHMFAPVLDGAISTLLGVLMLAGSEFDFILRYFFAVLTILTILGL 1144
Cdd:TIGR00918 1024 ILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGV 1103
                         1130      1140
                   ....*....|....*....|....*...
gi 147899864  1145 LNGLVLLPVLLSLIGPPAEVTPADNSSR 1172
Cdd:TIGR00918 1104 LNGLVLLPVLLSMFGPEPEVSPAEGRSR 1131
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
26-1172 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 1829.89  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864    26 APSSDLLRRPSYCHAAFALKQIAKGKAVGQKAPLWLRAQFQALLFSLGCSIQRHCGKVLFIGLLVFGALAVGLRVASIET 105
Cdd:TIGR00918    4 APDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIET 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   106 DIERLWVEAGSRVSHELRYTKEKLGEESVYTSQMLIQTPKREGENILTHEALLLHLRAALAASKVQVSMYGKSWDLNKIC 185
Cdd:TIGR00918   84 NVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLC 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   186 YKSGVPIIENGMIERMIEKLFPCVIITPLDCFWEGSQLQGGSAYLPGRADIQWTNLDPIRLMEELGQFTS-LDGFKEMLD 264
Cdd:TIGR00918  164 YKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSqVESWEEMLK 243
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   265 KAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRGGCYGFSKKFMYWQKELILGGMLKGPNGELKSAEALQTM 344
Cdd:TIGR00918  244 KAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSM 323
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   345 YLLMSPGQLFEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQAQQSVPQNSSQDIHAFSTTTLNDIMKSFSDVSAIRVA 424
Cdd:TIGR00918  324 FQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIV 403
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   425 GGYLLMLAYACVTLLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFT 504
Cdd:TIGR00918  404 SGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFS 483
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   505 ETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRRED 584
Cdd:TIGR00918  484 ETGQNIPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRRED 563
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   585 QRLDILCCFYSPCSSRVIQIQPQEFSDandnhtyhpssyGNPTITTSTQITTTVQAFTQCDPSGHHIVTILPPTSQISTS 664
Cdd:TIGR00918  564 RRLDIFCCFFSPCSARVIQIEPQAYAD------------GSAPPVYSSHMQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQ 631
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   665 PSvivptmDPLGSQIFTPSSSTRDLLAQLDESKEKreCVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVTLFMALLGLG 744
Cdd:TIGR00918  632 PS------DPLSCQSPDIAGSTRDLLSQFEDSKAA--CLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLS 703
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   745 LYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKM 824
Cdd:TIGR00918  704 LYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGNFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRM 783
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   825 WLHYFQDWLRGLQTSFDMDWESGYITQDSYRNGTEDGVLAYKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYL 904
Cdd:TIGR00918  784 WLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYL 863
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   905 TVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTGENLRIPATEPIEFAQFPFYLNGLRQTSDFVEAIESVRSVCEEFVKQ 984
Cdd:TIGR00918  864 SAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPENLRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGF 943
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   985 GVHSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVV 1064
Cdd:TIGR00918  944 GLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVV 1023
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1065 ILIASVGIGVEFTVHVALGFLTAIGDRNQRSVLALEHMFAPVLDGAISTLLGVLMLAGSEFDFILRYFFAVLTILTILGL 1144
Cdd:TIGR00918 1024 ILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGV 1103
                         1130      1140
                   ....*....|....*....|....*...
gi 147899864  1145 LNGLVLLPVLLSLIGPPAEVTPADNSSR 1172
Cdd:TIGR00918 1104 LNGLVLLPVLLSMFGPEPEVSPAEGRSR 1131
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
443-593 9.84e-55

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 315102  Cd Length: 153  Bit Score: 190.50  E-value: 9.84e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   443 CSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRR 522
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAVGVDNIFILVKAVQRTPRSLDVSERIAEALGE 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 147899864   523 TGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRREDQRLDILCCF 593
Cdd:pfam12349   81 VGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVAVLFDFLLQITFFVAVLSLDIRREESNRLDVFCCV 151
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
332-575 8.28e-11

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964  Cd Length: 727  Bit Score: 66.56  E-value: 8.28e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  332 NGELKSAEALQTMYLLMSPGQLFEHFKDDYEIHdINWNEEKAAAILESWQRKFVEQAQQSVPQNssqDIHAFSTTT---- 407
Cdd:COG1033   484 GGIIPDKSKIQIILEELPESIKKRYISGDQLNL-LGYSLGDTQGELEDVGREILRDIEKENIPT---GVKVYVTGEsviy 559
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  408 --LND-IMKSFSDVSAIrvagGYLLMLAYACVTLLRWdcsksqgAVGLAGVLLVALSVASGLGLCSLLGISFNAATtQVL 484
Cdd:COG1033   560 veMNElLTSSQLISTVL----GIILVFALLLIIFRSP-------LKAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATL 627
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  485 PFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFfmAALV--PIPALRAFSLQAAVIVVF 562
Cdd:COG1033   628 GAIILGIGVDYSIHITERYREERKKGGPKEAIETTVERTGKAILASALTTAIGF--LALIfsPFPIISNFGLLTVIGILL 705
                         250
                  ....*....|...
gi 147899864  563 NFAMVLLIFPAIL 575
Cdd:COG1033   706 SLLASLVLLPALL 718
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
26-1172 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 1829.89  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864    26 APSSDLLRRPSYCHAAFALKQIAKGKAVGQKAPLWLRAQFQALLFSLGCSIQRHCGKVLFIGLLVFGALAVGLRVASIET 105
Cdd:TIGR00918    4 APDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIET 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   106 DIERLWVEAGSRVSHELRYTKEKLGEESVYTSQMLIQTPKREGENILTHEALLLHLRAALAASKVQVSMYGKSWDLNKIC 185
Cdd:TIGR00918   84 NVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLC 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   186 YKSGVPIIENGMIERMIEKLFPCVIITPLDCFWEGSQLQGGSAYLPGRADIQWTNLDPIRLMEELGQFTS-LDGFKEMLD 264
Cdd:TIGR00918  164 YKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSqVESWEEMLK 243
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   265 KAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRGGCYGFSKKFMYWQKELILGGMLKGPNGELKSAEALQTM 344
Cdd:TIGR00918  244 KAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSM 323
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   345 YLLMSPGQLFEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQAQQSVPQNSSQDIHAFSTTTLNDIMKSFSDVSAIRVA 424
Cdd:TIGR00918  324 FQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIV 403
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   425 GGYLLMLAYACVTLLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFT 504
Cdd:TIGR00918  404 SGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFS 483
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   505 ETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRRED 584
Cdd:TIGR00918  484 ETGQNIPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRRED 563
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   585 QRLDILCCFYSPCSSRVIQIQPQEFSDandnhtyhpssyGNPTITTSTQITTTVQAFTQCDPSGHHIVTILPPTSQISTS 664
Cdd:TIGR00918  564 RRLDIFCCFFSPCSARVIQIEPQAYAD------------GSAPPVYSSHMQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQ 631
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   665 PSvivptmDPLGSQIFTPSSSTRDLLAQLDESKEKreCVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVTLFMALLGLG 744
Cdd:TIGR00918  632 PS------DPLSCQSPDIAGSTRDLLSQFEDSKAA--CLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLS 703
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   745 LYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKM 824
Cdd:TIGR00918  704 LYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGNFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRM 783
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   825 WLHYFQDWLRGLQTSFDMDWESGYITQDSYRNGTEDGVLAYKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYL 904
Cdd:TIGR00918  784 WLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYL 863
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   905 TVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTGENLRIPATEPIEFAQFPFYLNGLRQTSDFVEAIESVRSVCEEFVKQ 984
Cdd:TIGR00918  864 SAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPENLRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGF 943
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   985 GVHSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVV 1064
Cdd:TIGR00918  944 GLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVV 1023
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1065 ILIASVGIGVEFTVHVALGFLTAIGDRNQRSVLALEHMFAPVLDGAISTLLGVLMLAGSEFDFILRYFFAVLTILTILGL 1144
Cdd:TIGR00918 1024 ILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGV 1103
                         1130      1140
                   ....*....|....*....|....*...
gi 147899864  1145 LNGLVLLPVLLSLIGPPAEVTPADNSSR 1172
Cdd:TIGR00918 1104 LNGLVLLPVLLSMFGPEPEVSPAEGRSR 1131
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
63-1133 2.91e-57

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337  Cd Length: 1205  Bit Score: 217.85  E-value: 2.91e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864    63 AQFQALLFSL----GCSIQRHCGKVLFIGLLVFGALAVGLRVASIETDIERLWVEAGSRVSHELRYTKEKLGeeSVYTSQ 138
Cdd:TIGR00917  303 STVQGHLARFfgkyGIWVARHPTLVICLSVSVVLLLCVGLIRFKVETRPVKLWVAPGSRAALEKQYFDTHFG--PFYRIE 380
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   139 MLIQTPKREGEN-----ILTHEALLLHLRAALAASKVQVSMYGKSWDLNKICYKSGVPIieNGMIERMIEKLFPcviitp 213
Cdd:TIGR00917  381 QLIIATVQTSSHekapeILTDDNLKLLFDIQKKVSQLFANYEGELITLDSPCFKPNHPY--NCFIYSTCKKLQN------ 452
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   214 ldcfwegsqlqggsaylpgradiQWTNLDPIRlMEELGQFTSLDGFKEMLDKAEvgqaymerPCLDptdsdcpesspnkk 293
Cdd:TIGR00917  453 -----------------------MYSKLKPEN-YDDYGGVDYVKYCFEHFTSPE--------SCLS-------------- 486
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   294 TKKNPdivstlrggcygfskkfmyWQKELILGGMlkgPNGELKSAEALQTMYLLmspgqlfEHFKDDYEihdinwNEEKA 373
Cdd:TIGR00917  487 AFGGP-------------------VDPTTVLGGF---SGNNFSEASAFVVTFPV-------NNFVNKTN------KTEKA 531
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   374 AAilesWQRKFVEQAQQSVPQNSSQDIHAFSTTTLNDIMKSFSDVSAIRVAGGYLLMLAYACVTL-----LRWDCSKSQG 448
Cdd:TIGR00917  532 VA----WEKAFIQLAKDELLPMVQATISFSAERSIEDELKRESTADVITIAISYLVMFAYISLTLgdsprLKSLYVTSKV 607
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   449 AVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAF-----------TETSRSTPFKDRTG 517
Cdd:TIGR00917  608 LLGLSGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYfyleyfyrqvgVDNEQELTLERRLS 687
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   518 ECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRREDQRLDILCCfyspc 597
Cdd:TIGR00917  688 RALMEVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPC----- 762
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   598 ssrviqiqpqefsdandnhtyhpssygnptittstqitttvqaftqcdpsghhivtILPPTSQISTSPSVivptmdplgs 677
Cdd:TIGR00917  763 --------------------------------------------------------IKTSKSSISAEKGS---------- 776
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   678 qiftpssstrdllaqldeSKEKRECvplpflkwsLSDFAREKYAPVLLKAETKGIVVTLFMALLGLGLYGTTMVHDGLYL 757
Cdd:TIGR00917  777 ------------------GQRKAGL---------LTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQ 829
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   758 TDIVPRETkeynFISAQFKYFSFY-----NMFIVTKDGFDYPKAqESLYDLHEAFGSVKYVVREEGRDLPKM------WL 826
Cdd:TIGR00917  830 QIVLPQDS----YLQIYFASLTPLlevgpPFYIVIKGDYNYTDF-ESQNKLCTMGGCDKDSIVNVFNNLSYIakpassWL 904
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   827 HYFQDWLRGlQTSFDMDwesgYITQDSYRNGTEDGVLAYKLLIQTGNKKEPfnfnqltsrrlvdekgliPQDaFYIYLTV 906
Cdd:TIGR00917  905 DDYLVWLSP-QASCCCR----KFTNGTFCNGPDPQCFRCADLSSDAQGRPS------------------TTQ-FKEKLPW 960
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   907 WVSNDPLGYAASQANFYpqppewIHDRYDTTGENLRIPATepiefaQFPFYLNGLRQTSDFVEAIESVRSVCEEFVKQ-G 985
Cdd:TIGR00917  961 FLNALPSADCAKGGHAA------YSSAVDLQGYATIIQAS------SFRTYHTPLNTQVDFINAMRAAQEFAAKVSRSsK 1028
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   986 VHSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILL-LNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVV 1064
Cdd:TIGR00917 1029 MEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLqLNALSVVNLIMSVGMAVVFCVGIMHLWSISLNAVSVV 1108
                         1050      1060      1070      1080      1090      1100      1110
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 147899864  1065 ILIASVGIGVEFTVHVALGFLTAI-GDRNQRSVLALEHMFAPVLDG-AISTLLGVLMLAGSEFDFILRYFF 1133
Cdd:TIGR00917 1109 NSVMHKGIAIEFCTHINAQFSTGKhFSRNHRAKEALGGMGSSVFSGiTLTKLVGVVVLGFSRSEIFVVYYF 1179
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
443-593 9.84e-55

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 315102  Cd Length: 153  Bit Score: 190.50  E-value: 9.84e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   443 CSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRR 522
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAVGVDNIFILVKAVQRTPRSLDVSERIAEALGE 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 147899864   523 TGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQRREDQRLDILCCF 593
Cdd:pfam12349   81 VGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVAVLFDFLLQITFFVAVLSLDIRREESNRLDVFCCV 151
Patched pfam02460
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
322-1121 2.06e-51

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


Pssm-ID: 308203  Cd Length: 793  Bit Score: 196.04  E-value: 2.06e-51
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   322 LILGGMLKGPNGELKSAEALQTMYLLmspgqlfehfkddyeihdiNWNEEKAAAILESWQR---KFVEQAQQSVPQNssq 398
Cdd:pfam02460  138 PHFGGVDFEPPGNISYAKAIVLWYFL-------------------KFDEEEVEEDSKEWEDelsQLLHNKYASEHIQ--- 195
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   399 dIHAFSTTTLNDIMKSFSDVSAIRVAGGYLLMLAYACVTL--LRW---DCSKSQGAVGLAGVLLVALSVASGLGLCSLLG 473
Cdd:pfam02460  196 -FTIFHDQILNDELVRNALTLTPFFVIGFFLLLTFSIIVSvtLSSytiDWVRSKPILAALGLLSPVMAIVSSFGLLFWMG 274
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   474 ISFNAATTqVLPFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFS 553
Cdd:pfam02460  275 FPFNSIVC-VTPFLVLAIGVDDMFLMVAAWQRTTATLSVKKRMGEALSEAGVSITITSLTDVLSFGIGTYTPTPAIQLFC 353
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   554 LQAAVIVVFNFAMVLLIFPAILSLDLQRREDQRldiLCCFyspcssrviqiqpqefsdandnhtyhpssygnptittstq 633
Cdd:pfam02460  354 AYTAVAIFFDFIYQITFFAAIMAICAKPEAEGR---HCLF---------------------------------------- 390
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   634 itttvqaftqcdpsghhivtiLPPTSQISTspsvivptmdplgsqiftpsssTRDLLAQLDESKEKRECVplpflkwslS 713
Cdd:pfam02460  391 ---------------------VWATSSPQR----------------------IDSEGSEPDKSHNIEQLK---------S 418
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   714 DFAREKYAPVLLKAETKGIVVTLFMALLGLGLYGTTMVHDGLYLTDIVPRETK--EYNFISAQ--FKYFSFYNMFIVTKD 789
Cdd:pfam02460  419 RFFLDIYCPFLLNPSVRVCMLVLFVVYIAIAIYGCVNIKEGLEPDKLVLEDSPlvEYLSLREKhfWPEGLQIQVAVNNPP 498
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   790 GFDYPKAQESLYDLHEAFGSVKYVVreeGRDLPKMWLHYFQDWLRGLQTSFDMDWESGYITqdsyrnGTEDGVLAYKlli 869
Cdd:pfam02460  499 NLTIPESRDRMNEMVDEFENTPYSL---GPNSTLFWLREYENFLSTLNMEEEEDEEKEWSY------GNLPSFLKAP--- 566
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   870 qtgnkkepfnFNQLTSRRLV-DEKGLIPQdAFyiyltvwvsndplgyaasqanfypqppewihdRYDTTGENLRIPatep 948
Cdd:pfam02460  567 ----------GNSHWAGDLVwDDNTTMVT-KF--------------------------------RFTLAGKGLSTW---- 599
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   949 iefaqfpfylnglrqtSDFVEAIESVRSVCEEFVKQGVHSYPSGYPFLfwEQYIGLRHWFLLAISIVLACTFLVCAILLL 1028
Cdd:pfam02460  600 ----------------NDRTRALQEWRSIADQYPEFNVTVFDEDAPFA--DQYLTILPSTIQNIVITLICMFIVCFLFIP 661
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1029 NPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFLTAIG-DRNQRSVLALEHMFAPVL 1107
Cdd:pfam02460  662 NPPCVFVITLAIASIDIGVFGFLSLWGVDLDPISMITIIMSIGFSVDFSAHIAYHFVRSRGdTPAERVVDALEALGWPVF 741
                          810
                   ....*....|....
gi 147899864  1108 DGAISTLLGVLMLA 1121
Cdd:pfam02460  742 QGGLSTILGVLVLL 755
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
332-575 8.28e-11

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964  Cd Length: 727  Bit Score: 66.56  E-value: 8.28e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  332 NGELKSAEALQTMYLLMSPGQLFEHFKDDYEIHdINWNEEKAAAILESWQRKFVEQAQQSVPQNssqDIHAFSTTT---- 407
Cdd:COG1033   484 GGIIPDKSKIQIILEELPESIKKRYISGDQLNL-LGYSLGDTQGELEDVGREILRDIEKENIPT---GVKVYVTGEsviy 559
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  408 --LND-IMKSFSDVSAIrvagGYLLMLAYACVTLLRWdcsksqgAVGLAGVLLVALSVASGLGLCSLLGISFNAATtQVL 484
Cdd:COG1033   560 veMNElLTSSQLISTVL----GIILVFALLLIIFRSP-------LKAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATL 627
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  485 PFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTLTSINNMIAFfmAALV--PIPALRAFSLQAAVIVVF 562
Cdd:COG1033   628 GAIILGIGVDYSIHITERYREERKKGGPKEAIETTVERTGKAILASALTTAIGF--LALIfsPFPIISNFGLLTVIGILL 705
                         250
                  ....*....|...
gi 147899864  563 NFAMVLLIFPAIL 575
Cdd:COG1033   706 SLLASLVLLPALL 718
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
450-577 1.35e-08

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340  Cd Length: 719  Bit Score: 59.08  E-value: 1.35e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   450 VGLAGVLLVALSVASGLGLCSLLGISFNAaTTQVLPFLALGIGVDDMFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTL 529
Cdd:TIGR00921  593 KAVFPLIAIGSGILWAIGLMGLRGIPSFL-AMATTISIILGLGMDYSIHLAERYFEERKEHGPKEAITHTMERTGPGILF 671
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 147899864   530 TSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSL 577
Cdd:TIGR00921  672 SGLTTAGGFLSLLLSHFPIMRNFGLVQGIGVLSSLTAALVVFPALLVL 719
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
922-1128 7.41e-08

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964  Cd Length: 727  Bit Score: 56.93  E-value: 7.41e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  922 FYPQPPEWIHDRYDTTGENLRIpatepiefaqfpFYLNGLRQTSDFVEAIESVRSVCEEFVKQGVHSYPSGYPFLFWEQY 1001
Cdd:COG1033   496 ILEELPESIKKRYISGDQLNLL------------GYSLGDTQGELEDVGREILRDIEKENIPTGVKVYVTGESVIYVEMN 563
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864 1002 IGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVA 1081
Cdd:COG1033   564 ELLTSSQLISTVLGIILVFALLLIIFRSPLKAIIPLIPIAIVVGWNFGLMGLLGIPLTPATATLGAIILGIGVDYSIHIT 643
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 147899864 1082 LGFLTAI--GDRNQRSVLALEHMFAPVLDGAISTLLGVLMLAGSEFDFI 1128
Cdd:COG1033   644 ERYREERkkGGPKEAIETTVERTGKAILASALTTAIGFLALIFSPFPII 692
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
451-577 8.31e-07

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964  Cd Length: 727  Bit Score: 53.46  E-value: 8.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  451 GLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLaLGIGVDD-MFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTL 529
Cdd:COG1033   223 ALLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYgVHFHNRYEEERRKGRTVEEAVVEAIKHTGPAVLI 301
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 147899864  530 TSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSL 577
Cdd:COG1033   302 AALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALLIL 349
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
451-591 1.48e-06

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340  Cd Length: 719  Bit Score: 52.53  E-value: 1.48e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   451 GLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLaLGIGVDDMFLLAHAFTETSRSTPFKDRTG-ECLRRTGTSVTL 529
Cdd:TIGR00921  220 PLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVPML-IGVGIDYGIQTLNRYEEERDIGRAKGEAIvTAVRRTGRAVLI 298
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 147899864   530 TSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAIL-SLDLQRREDQRLDILC 591
Cdd:TIGR00921  299 ALLTTSAGFAALALSEFPMVSEFGLGLVAGLITAYLLTLLVLPALLqSIDIGREKVKKEIIAI 361
YdfJ COG2409
Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];
448-577 6.30e-06

Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];


Pssm-ID: 225272  Cd Length: 937  Bit Score: 50.88  E-value: 6.30e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  448 GAVGLAGVLL--VALSVASGLGLCSLLGISFNAAT-TQVLPF---LALGIGVD-DMFLLAhAFTETSRSTpfKDRT---G 517
Cdd:COG2409   206 RSVITAFLPLitVGLSLLVAQGIVALLAYAFGLGVsTFALSLlvaLGIGAGTDyALFLVS-RYREELREG--QDREaavG 282
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  518 ECLRRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSL 577
Cdd:COG2409   283 TAYRTAGKTVAFSGLTVAIALLGLSFARLPFLKTLGIAAAIGVAVAVLAALTLLPALLAL 342
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
956-1128 5.05e-05

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340  Cd Length: 719  Bit Score: 47.52  E-value: 5.05e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   956 FYLNGLRQTsDFVEAIESV-RSVCEEFVKQGVHSYPSGYPFLFWEQYIGLRHWFLlaiSIVLACTFLVCAILLL---NPW 1031
Cdd:TIGR00921  517 VIQVQLKQG-EPKVQGRKIlRDVQHEHPPPGVKVGVTGLPVAFAEMHELVNEGMR---RMTIAGAILVLMILLAvfrNPI 592
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1032 TAgiIVFILAMMTVELF--GIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFLTaigDRNQRSVL-----ALEHMFA 1104
Cdd:TIGR00921  593 KA--VFPLIAIGSGILWaiGLMGLRGIPSFLAMATTISIILGLGMDYSIHLAERYFE---ERKEHGPKeaithTMERTGP 667
                          170       180
                   ....*....|....*....|....
gi 147899864  1105 PVLDGAISTLLGVLMLAGSEFDFI 1128
Cdd:TIGR00921  668 GILFSGLTTAGGFLSLLLSHFPIM 691
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
958-1131 7.60e-05

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340  Cd Length: 719  Bit Score: 47.14  E-value: 7.60e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   958 LNGLRQTSDFVEAIESVRSVCEEF-VKQGVHSYPSGYPFLFWEQYIGLRHWF--LLAISIVLactflVCAILLL---NPW 1031
Cdd:TIGR00921  144 LKSDADYKQVVPIYNDVERSLERTnPPSGKFLDVTGSPAINYDIEREFGKDMgtTMAISGIL-----VVLVLLLdfkRWW 218
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  1032 TAGIIVFILAMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFLTAIG---DRNQRSVLALEHMFAPVLD 1108
Cdd:TIGR00921  219 RPLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVPMLIGVGIDYGIQTLNRYEEERDigrAKGEAIVTAVRRTGRAVLI 298
                          170       180
                   ....*....|....*....|...
gi 147899864  1109 GAISTLLGVLMLAGSEFDFILRY 1131
Cdd:TIGR00921  299 ALLTTSAGFAALALSEFPMVSEF 321
MMPL pfam03176
MMPL family; Members of this family are putative integral membrane proteins from bacteria. ...
448-577 7.62e-05

MMPL family; Members of this family are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport.


Pssm-ID: 308676  Cd Length: 332  Bit Score: 46.52  E-value: 7.62e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   448 GAVGLAGVLL--VALSVASGLGLCSLL-GISFNAATTQVLPF---LALGIGVD-DMFLLAHaFTETSRSTPFKDRT-GEC 519
Cdd:pfam03176  164 RSVVAALLPLltVGLSLGAAQGLVAILaHILGIGLSTFALNLlvvLLIAVGTDyALFLVSR-YREELRAGEDREEAvIRA 242
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 147899864   520 LRRTGTSVT---LTsinnmIAFFMAALV--PIPALRAFSLQAAVIVVFNFAMVLLIFPAILSL 577
Cdd:pfam03176  243 VRGTGKVVTaagLT-----VAIAMLALSfaRLPVFAQVGPTIAIGVLVDVLAALTLLPALLAL 300
actII TIGR00833
Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family ...
450-581 3.62e-04

Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family (TC 2.A.6.5)Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. This sub-family includes the S. coelicolor ActII3 protein, which may play a role in drug resistance, and the M. tuberculosis MmpL7 protein, which catalyzes export of an outer membrane lipid, phthiocerol dimycocerosate. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 129913  Cd Length: 910  Bit Score: 44.96  E-value: 3.62e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   450 VGLAGVLLVALSVASGLGLCSLLGISF--NAATTQVLPF---LALGIGVDDMFLLAHAFTETSRSTPfkdRTGECLRRTG 524
Cdd:TIGR00833  770 APIVLIGSVALSYLWALGLSVLAFQHIlgAELHWSVLAGvfvLLVALGVDYNMLLVSRIKEESPAGN---RTGIIRALGS 846
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 147899864   525 TSVTLTSINNMIAFFMAALV--PIPALRAFSLQAAVIVVFNFAMVLLIFPAILSLDLQR 581
Cdd:TIGR00833  847 TGGVITAAGLVFAGTMAALAsaQLTAIAQFGFTVGVGILLDTFIVRSVTVPALTLLLGR 905
HpnN TIGR03480
hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing ...
382-575 3.90e-04

hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921.


Pssm-ID: 274598  Cd Length: 862  Bit Score: 44.99  E-value: 3.90e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   382 RKFVEQAQQSVPQNSSQDIhafSTTTLNDIMksfsdVSAIRVAGGY-LLMLAYACVTLLRwdcSKSQGAVGLAGVLLVAL 460
Cdd:TIGR03480  683 RRFVRAVRKVAPDATGAPV---SILESGDTV-----VGAFLQAFIYaLVAITVLLLLTLR---RVRDVLLVLAPLLLAGL 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   461 SVasgLGLCSLLGISFNAATTQVLPFLaLGIGVDDMFLLAHAFTETsrstpfKDRTGECLRRTGTSVTLTSINNMIAFFM 540
Cdd:TIGR03480  752 LT---VAAMVLLGIPFNFANIIALPLL-LGLGVDFGIYMVHRWRNG------VDSGNLLQSSTARAVFFSALTTATAFGS 821
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 147899864   541 AALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAIL 575
Cdd:TIGR03480  822 LAVSSHPGTASMGILLSLGLGLTLLCTLIFLPALL 856
COG4258 COG4258
Predicted exporter [General function prediction only];
418-573 1.78e-03

Predicted exporter [General function prediction only];


Pssm-ID: 226709  Cd Length: 788  Bit Score: 42.55  E-value: 1.78e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864  418 VSAIRVAGGYLLMLAYACVtLLRWdcskSQGAVGLAGVLLVALSVASGLGLCsllGISFNAATTQVLpFLALGIGVDDMF 497
Cdd:COG4258   647 VLAGLLAGALALVLCLAVA-RRGW----RRGLRVLLPSVLALGCGLAVLAMA---GVPLNLFHLLAL-VLVLGVGINYAL 717
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 147899864  498 LLAHAftETSRSTPFkdrtgeclrRTGTSVTLTSINNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPA 573
Cdd:COG4258   718 FFSNA--GDPRAEPL---------TTLLALALAMLTTLLTFGLLAFSATPVLSSFGITLASGIILAFVLAPLAMPD 782
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
1035-1125 2.00e-03

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964  Cd Length: 727  Bit Score: 42.29  E-value: 2.00e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864 1035 IIVFILAMMTvelFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFLTAIGDRN---QRSVLALEHMFAPVLDGAI 1111
Cdd:COG1033   228 IIVLVSVLWT---LGAMGLLGIPLTITTSAVPPLLIGIGIDYGVHFHNRYEEERRKGRtveEAVVEAIKHTGPAVLIAAL 304
                          90
                  ....*....|....
gi 147899864 1112 STLLGVLMLAGSEF 1125
Cdd:COG1033   305 TTAAGFLSLLTSSI 318
actII TIGR00833
Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family ...
458-577 9.68e-03

Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family (TC 2.A.6.5)Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. This sub-family includes the S. coelicolor ActII3 protein, which may play a role in drug resistance, and the M. tuberculosis MmpL7 protein, which catalyzes export of an outer membrane lipid, phthiocerol dimycocerosate. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 129913  Cd Length: 910  Bit Score: 40.34  E-value: 9.68e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899864   458 VALSVASGLGLCSLLG----ISFNAATTQVLPFLALGIGVD-DMFLLAHAFTETSRSTPFKDRTGECLRRTGTSVTLTSI 532
Cdd:TIGR00833  207 VGFSVVVAQGIVSLLGipglIGVNAQTTVLLTALVIGAGTDyAVFLTGRYHEERRKGESLEEAAAEALRGTGKAILGSAL 286
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*
gi 147899864   533 NNMIAFFMAALVPIPALRAFSLQAAVIVVFNFAMVLLIFPAILSL 577
Cdd:TIGR00833  287 TVAVAFLALSLARLPSFKTLGVSCAVGVLVALLNAVTLTPALLTL 331
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH