NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147898447|ref|NP_001083171|]
View 

uncharacterized protein LOC398783 [Xenopus laevis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
OATP super family cl27295
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
17-628 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


The actual alignment was detected with superfamily member TIGR00805:

Pssm-ID: 332116  Cd Length: 632  Bit Score: 583.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   17 SKLKIFIFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIM 96
Cdd:TIGR00805  29 SKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGCAIM 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   97 SLGSGLAALPHLLMPRYEYESTVSTTSNSTSRVP-LCLANQSLSHN-VELPGECLGGSMSLMWIFVLVGNLLKGIGETPV 174
Cdd:TIGR00805 109 GLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSANSfLCMENLTQTLRpTQDPSECQKQHKSLMWLLFLVSNILRGIGATPI 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  175 EPLGLSYVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYVDIGSINLDDVTIAQTDIRWVGAWWIGFFASSGA 254
Cdd:TIGR00805 189 FPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWIGFLVCGFV 268
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  255 CFLATLLFWFLPKSLPREGGERETEPSETltlETEEHKGQNTSNEQAPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAF 334
Cdd:TIGR00805 269 ALLTSIPLFFFPKTLPKEGKRVNVDVHEA---EKLEKSRGEDRKKNSGITKDFPKFIKRLLCNKIYMLVILAQVIDVLAF 345
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  335 SGYFSFLPKFVEQQYGKSPSEAIFLIGVYNLPIISLGYFLGGYYMKRFNVSTYRAAQIGFISEIMTFSINFSVFVMGCKN 414
Cdd:TIGR00805 346 NGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAYFAICLSTLEYLLYSPKFLITCES 425
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  415 SPVMDLTVlyDGTDHISYLNNFTsSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSCVlasPFP 494
Cdd:TIGR00805 426 APVAGVNN--PSNDQPLYVENRT-DCNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRMSVGTGSNMVFTNCSCI---QTP 499
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  495 SNGSATLGQCPreETCDSMLIYFMVMSFICCLIFSFGAMPAYMVLIRSLKPEEKSLGLGLHLLAARTVGGIPSLVSFGVL 574
Cdd:TIGR00805 500 GNSSAKKGLCD--PPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLGLGLQWFCIRVFGTIPAPILFGAL 577
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|....
gi 147898447  575 VDSTCLKWGVLECGEPGACRIYDTDLFRYLFNGIQCVIRMSSYVPCIFILLSLK 628
Cdd:TIGR00805 578 IDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILAR 631
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
17-628 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279  Cd Length: 632  Bit Score: 583.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   17 SKLKIFIFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIM 96
Cdd:TIGR00805  29 SKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGCAIM 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   97 SLGSGLAALPHLLMPRYEYESTVSTTSNSTSRVP-LCLANQSLSHN-VELPGECLGGSMSLMWIFVLVGNLLKGIGETPV 174
Cdd:TIGR00805 109 GLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSANSfLCMENLTQTLRpTQDPSECQKQHKSLMWLLFLVSNILRGIGATPI 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  175 EPLGLSYVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYVDIGSINLDDVTIAQTDIRWVGAWWIGFFASSGA 254
Cdd:TIGR00805 189 FPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWIGFLVCGFV 268
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  255 CFLATLLFWFLPKSLPREGGERETEPSETltlETEEHKGQNTSNEQAPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAF 334
Cdd:TIGR00805 269 ALLTSIPLFFFPKTLPKEGKRVNVDVHEA---EKLEKSRGEDRKKNSGITKDFPKFIKRLLCNKIYMLVILAQVIDVLAF 345
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  335 SGYFSFLPKFVEQQYGKSPSEAIFLIGVYNLPIISLGYFLGGYYMKRFNVSTYRAAQIGFISEIMTFSINFSVFVMGCKN 414
Cdd:TIGR00805 346 NGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAYFAICLSTLEYLLYSPKFLITCES 425
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  415 SPVMDLTVlyDGTDHISYLNNFTsSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSCVlasPFP 494
Cdd:TIGR00805 426 APVAGVNN--PSNDQPLYVENRT-DCNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRMSVGTGSNMVFTNCSCI---QTP 499
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  495 SNGSATLGQCPreETCDSMLIYFMVMSFICCLIFSFGAMPAYMVLIRSLKPEEKSLGLGLHLLAARTVGGIPSLVSFGVL 574
Cdd:TIGR00805 500 GNSSAKKGLCD--PPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLGLGLQWFCIRVFGTIPAPILFGAL 577
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|....
gi 147898447  575 VDSTCLKWGVLECGEPGACRIYDTDLFRYLFNGIQCVIRMSSYVPCIFILLSLK 628
Cdd:TIGR00805 578 IDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILAR 631
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-601 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 308646  Cd Length: 526  Bit Score: 558.33  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   21 IFIFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIMSLGS 100
Cdd:pfam03137   1 GFLVFLCLLGLLQAMVSGYFNSSITTIEKRFGLPSSTSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGIGALLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  101 GLAALPHLlmpryeyestvsttsnstsrvplclanqslshnvelpgeclggsmslmwIFVLVGNLLKGIGETPVEPLGLS 180
Cdd:pfam03137  81 LLFALPHF-------------------------------------------------LSFFLGQLLLGIGATPIYTLGIS 111
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  181 YVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYVDIGSinldDVTIAQTDIRWVGAWWIGFFASSGACFLATL 260
Cdd:pfam03137 112 YIDDNVKKKNSPLYIGILYAVRMLGPALGFLLGSLCLRLYVDPGS----SITLTPKDPRWVGAWWLGFLIAGVLLLLTAI 187
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  261 LFWFLPKSLPREGGERETEPSETLTlETEEHKGQNTSNEQAPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAFSGYFSF 340
Cdd:pfam03137 188 PFFFFPKSLPGAKKLRAERRKEPHK-EEKKDKEKGTSIKLGKSLKDFPKALKRLLKNPVYMLLTLASVFESLGIAGFATF 266
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  341 LPKFVEQQYGKSPSEAIFLIGVYNLPIISLGYFLGGYYMKRFNVSTYRAAQIGFISEIMTFSINFSVFVMGCKNSPVMDL 420
Cdd:pfam03137 267 LPKYLETQFGLSASTANLLTGIVVIPGAALGILLGGLIIKKFKLSAKGAAKFNLVTSLLSLLLSLLLFFLGCDNSPVAGL 346
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  421 TVLYDGTDHISyLNNFTSSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSC---VLASPFPSNG 497
Cdd:pfam03137 347 TVPYGGTGQLS-EGNLTASCNSDCSCSSSFYSPVCGSDGYGYTSPCPCGCGCSSSSGGGKNYYNCSCcccCLSSGGGGNG 425
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  498 SATLGQCPREetCDSMLIYFMVMSFICCLIFSFGAMPAYMVLIRSLKPEEKSLGLGLHLLAARTVGGIPSLVSFGVLVDS 577
Cdd:pfam03137 426 SAVPGKCPSD--CSNKLPLFLALLFLLSFFGALSSTPSTLIILRCVPPEDKSFALGLQFLILRLLGFIPGPIIFGALIDS 503
                         570       580
                  ....*....|....*....|....
gi 147898447  578 TCLKWGvLECGEPGACRIYDTDLF 601
Cdd:pfam03137 504 TCLLWT-KTCGGRGACWLYDNDKF 526
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
436-488 2.02e-25

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 101.23  E-value: 2.02e-25
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 147898447 436 FTSSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSCV 488
Cdd:cd01330    1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCV 53
 
Name Accession Description Interval E-value
oat TIGR00805
sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2. ...
17-628 0e+00

sodium-independent organic anion transporter; The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.


Pssm-ID: 273279  Cd Length: 632  Bit Score: 583.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   17 SKLKIFIFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIM 96
Cdd:TIGR00805  29 SKIKMFSLLLTCARLQGLLVNGLVNSMLTSIERRFKIPTSRSGFINGSYEIGNLLLIIFVSYFGTKLHRPIVIGAGCAIM 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   97 SLGSGLAALPHLLMPRYEYESTVSTTSNSTSRVP-LCLANQSLSHN-VELPGECLGGSMSLMWIFVLVGNLLKGIGETPV 174
Cdd:TIGR00805 109 GLGSLLSSLPHFLMGRYSYSTTVSSTGNLSSANSfLCMENLTQTLRpTQDPSECQKQHKSLMWLLFLVSNILRGIGATPI 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  175 EPLGLSYVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYVDIGSINLDDVTIAQTDIRWVGAWWIGFFASSGA 254
Cdd:TIGR00805 189 FPLGISYIDDFAKSKNSPLYIGILESGSVFGPAFGFLLGSFCLQIYVDTGSVNTEDLIITPTDPRWIGAWWIGFLVCGFV 268
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  255 CFLATLLFWFLPKSLPREGGERETEPSETltlETEEHKGQNTSNEQAPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAF 334
Cdd:TIGR00805 269 ALLTSIPLFFFPKTLPKEGKRVNVDVHEA---EKLEKSRGEDRKKNSGITKDFPKFIKRLLCNKIYMLVILAQVIDVLAF 345
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  335 SGYFSFLPKFVEQQYGKSPSEAIFLIGVYNLPIISLGYFLGGYYMKRFNVSTYRAAQIGFISEIMTFSINFSVFVMGCKN 414
Cdd:TIGR00805 346 NGYITFLPKYLENQYGISSAEANLLIGVVNVPPIGLGYLIGGFIMKKFKLNVKKAAYFAICLSTLEYLLYSPKFLITCES 425
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  415 SPVMDLTVlyDGTDHISYLNNFTsSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSCVlasPFP 494
Cdd:TIGR00805 426 APVAGVNN--PSNDQPLYVENRT-DCNRQCSCDSSIWDPVCGDNGLAYLSPCHAGCRMSVGTGSNMVFTNCSCI---QTP 499
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  495 SNGSATLGQCPreETCDSMLIYFMVMSFICCLIFSFGAMPAYMVLIRSLKPEEKSLGLGLHLLAARTVGGIPSLVSFGVL 574
Cdd:TIGR00805 500 GNSSAKKGLCD--PPCATSLQYFLILFIPLSFIYFITAVPGYMVLLRCVKSEERSLGLGLQWFCIRVFGTIPAPILFGAL 577
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|....
gi 147898447  575 VDSTCLKWGVLECGEPGACRIYDTDLFRYLFNGIQCVIRMSSYVPCIFILLSLK 628
Cdd:TIGR00805 578 IDVTCLHWQTLKCGASGACRMYDNDNLRVIYLGLTIALRGSSLLPLFFILILAR 631
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
21-601 0e+00

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 308646  Cd Length: 526  Bit Score: 558.33  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   21 IFIFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIMSLGS 100
Cdd:pfam03137   1 GFLVFLCLLGLLQAMVSGYFNSSITTIEKRFGLPSSTSGLISSSYDIGNLLLILFVSYFGGKGHRPRWIGIGALLMGLGS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  101 GLAALPHLlmpryeyestvsttsnstsrvplclanqslshnvelpgeclggsmslmwIFVLVGNLLKGIGETPVEPLGLS 180
Cdd:pfam03137  81 LLFALPHF-------------------------------------------------LSFFLGQLLLGIGATPIYTLGIS 111
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  181 YVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYVDIGSinldDVTIAQTDIRWVGAWWIGFFASSGACFLATL 260
Cdd:pfam03137 112 YIDDNVKKKNSPLYIGILYAVRMLGPALGFLLGSLCLRLYVDPGS----SITLTPKDPRWVGAWWLGFLIAGVLLLLTAI 187
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  261 LFWFLPKSLPREGGERETEPSETLTlETEEHKGQNTSNEQAPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAFSGYFSF 340
Cdd:pfam03137 188 PFFFFPKSLPGAKKLRAERRKEPHK-EEKKDKEKGTSIKLGKSLKDFPKALKRLLKNPVYMLLTLASVFESLGIAGFATF 266
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  341 LPKFVEQQYGKSPSEAIFLIGVYNLPIISLGYFLGGYYMKRFNVSTYRAAQIGFISEIMTFSINFSVFVMGCKNSPVMDL 420
Cdd:pfam03137 267 LPKYLETQFGLSASTANLLTGIVVIPGAALGILLGGLIIKKFKLSAKGAAKFNLVTSLLSLLLSLLLFFLGCDNSPVAGL 346
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  421 TVLYDGTDHISyLNNFTSSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSC---VLASPFPSNG 497
Cdd:pfam03137 347 TVPYGGTGQLS-EGNLTASCNSDCSCSSSFYSPVCGSDGYGYTSPCPCGCGCSSSSGGGKNYYNCSCcccCLSSGGGGNG 425
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  498 SATLGQCPREetCDSMLIYFMVMSFICCLIFSFGAMPAYMVLIRSLKPEEKSLGLGLHLLAARTVGGIPSLVSFGVLVDS 577
Cdd:pfam03137 426 SAVPGKCPSD--CSNKLPLFLALLFLLSFFGALSSTPSTLIILRCVPPEDKSFALGLQFLILRLLGFIPGPIIFGALIDS 503
                         570       580
                  ....*....|....*....|....
gi 147898447  578 TCLKWGvLECGEPGACRIYDTDLF 601
Cdd:pfam03137 504 TCLLWT-KTCGGRGACWLYDNDKF 526
KAZAL_SLC21 cd01330
The kazal-type serine protease inhibitor domain has been detected in an extracellular loop ...
436-488 2.02e-25

The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The KAZAL_SLC21 domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.


Pssm-ID: 238650  Cd Length: 54  Bit Score: 101.23  E-value: 2.02e-25
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 147898447 436 FTSSCNSPCDCPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSCV 488
Cdd:cd01330    1 LTSSCNSNCSCSESAYSPVCGENGITYFSPCHAGCTNSTGSGGSKIYTNCSCV 53
MFS_1 pfam07690
Major Facilitator Superfamily;
21-383 3.32e-11

Major Facilitator Superfamily;


Pssm-ID: 311564  Cd Length: 346  Bit Score: 65.14  E-value: 3.32e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   21 IFIFALSYAYVAKTLAYAYSESIITQierrFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIMSLGS 100
Cdd:pfam07690   1 LFLAAFLAALGRSLLGPALPLYLAED----LGISPSEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  101 GLAALPHllmpryeyestvsttsnstsrvplclanqslshnvelpgeclggsmslMWIFVLVGNLLKGIGETPVEPLGLS 180
Cdd:pfam07690  77 LLLLFAS------------------------------------------------SLWLLLVLRVLQGLGAGALFPAAAA 108
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  181 YVDEFSKKENSPFYIGIIQTISIVGPLLGYLLAALCAQLYvdigsinlddvtiaqtDIRWVgawwigFFASSGACFLATL 260
Cdd:pfam07690 109 LIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLF----------------GWRAA------FLILAILSLLAAV 166
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  261 LFWFLpkslpreggeretepsetLTLETEEHKGQNTSNEQAPGLSEFLRMIkslfRNKIYMLFMIVTVLQFNAFSGYFSF 340
Cdd:pfam07690 167 LAALL------------------LPRPPPESKRPKPAEEAPAPLLPAWKLL----LRDPVLWLLLALLLFGFAFFGLLTY 224
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 147898447  341 LPKFVEqQYGKSPSEAIFLIGVYNLpIISLGYFLGGYYMKRFN 383
Cdd:pfam07690 225 LPLYQE-VLGLSALLAGLLLGLAGL-LGAIGRLLLGRLSDRLG 265
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
446-487 3.82e-11

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 311539  Cd Length: 42  Bit Score: 60.34  E-value: 3.82e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 147898447  446 CPWDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSC 487
Cdd:pfam07648   1 CPRENDEPVCGSDGKTYGNKCALCCANCLLGEKLKVKYEGSC 42
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
23-382 3.03e-10

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392  Cd Length: 352  Bit Score: 61.95  E-value: 3.03e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  23 IFALSYAYVAKTLAYAYSESIITQIERRFNIPSSTIGIINGSFTIGNVLVIAFVSYFGAKLHRPKVIGLGCLIMSLGSGL 102
Cdd:cd06174    1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447 103 AALPHLlmpryeyestvsttsnstsrvplclanqslshnvelpgeclggsmslmWIFVLVGNLLKGIGETPVEPLGLSYV 182
Cdd:cd06174   81 LAFASS------------------------------------------------LWLLLVGRFLLGLGGGALYPAAAALI 112
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447 183 DEFSKKENSPFYIGIIQTISIVGPLLGYLLAALcaqlyvdigsinlddvtiaqtdIRWVGAWWIGFFASSGACFLATLLF 262
Cdd:cd06174  113 AEWFPPKERGRALGLFSAGFGLGALLGPLLGGL----------------------LAESLGWRWLFLILAILGLLLALLL 170
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447 263 WFLPKSLpreggeretepsetltleteehkgqntsneqapglseflrmikslfrnkiyMLFMIVTVLQFNAFSGYFSFLP 342
Cdd:cd06174  171 LFLLRLL---------------------------------------------------LLLALAFFLLSFGYYGLLTYLP 199
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 147898447 343 KFVEQQYGKSPSEAIFLIGVYNLPIIsLGYFLGGYYMKRF 382
Cdd:cd06174  200 LYLQEVLGLSAAEAGLLLSLFGLGGI-LGALLGGLLSDRL 238
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
446-487 2.42e-09

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 54.97  E-value: 2.42e-09
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 147898447 446 CPwDVWDPVCGDNGLVYISACHAGCTASVGEGQNTIFQNCSC 487
Cdd:cd00104    1 CP-KEYDPVCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
34-387 1.85e-03

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327  Cd Length: 398  Bit Score: 40.80  E-value: 1.85e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447   34 TLAYAYSESIITQierRFNIPSSTIGIInGSFTIGNVLVIAFVS-YFGAKLHRPKVIGLGCLIMSLGSGLAAL----PHL 108
Cdd:TIGR00895  33 LAAMGFAAPAISA---EWGLDPVQLGFL-FSAGLIGMAFGALFFgPLADRIGRRRVLLWSILLFSVFTLLCALatnvTQL 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  109 LMPRYeyestvsttsnstsrvplclanqslshnveLPGECLGGSMslmwifvlvgnllkgigetpvePLGLSYVDEFSKK 188
Cdd:TIGR00895 109 LILRF------------------------------LAGLGLGGLM----------------------PNLNALVSEYAPK 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  189 ENSPFYIGIIQtisiVGPLLGYLLAALCAQLYVdigsinlddvtiaqTDIRWVGAWWIGFFASsgaCFLATLLFWFLPKS 268
Cdd:TIGR00895 137 RFRGTAVGLMF----CGYPIGAAVGGFLAGWLI--------------PVFGWRSLFYVGGIAP---LLLLLLLMRFLPES 195
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147898447  269 L-------PREGGERETEPSETLTLETEEHKGQNTSNEqaPGLSEFLRMIKSLFRNKIYMLFMIVTVLQFNAFSGYFSFL 341
Cdd:TIGR00895 196 IdflvskrPETVRRIVNAIAPQMQAEAQSALPEQKSTQ--GTKRSVFKALFQGKTARITVLLWLLYFMLLVGVYFLTNWL 273
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*.
gi 147898447  342 PKFVEQQyGKSPSEAIFLIGVYNLPIIsLGYFLGGYYMKRFNVSTY 387
Cdd:TIGR00895 274 PKLMVEL-GFSLSLAATGGALFNFGGV-IGSIIFGWLADRLGPRVT 317
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH