NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|14715116|gb|AAH10726|]
View 

Phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) [Mus musculus]

Protein Classification

PAF-AH_p_II domain-containing protein (domain architecture ID 10506208)

PAF-AH_p_II domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PAF-AH_p_II pfam03403
Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor ...
47-415 0e+00

Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.


:

Pssm-ID: 251925  Cd Length: 372  Bit Score: 665.68  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116    47 AAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQ--DQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNIL-HLL 123
Cdd:pfam03403   1 AGSSGQVKIPAGNGPYPVGCTDLMIGHTLRGSFLRLYYPSDqaDEDREDTLWIPNKEYFQGLSEFLGTSSWLGNRLfALL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   124 YGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWL 203
Cdd:pfam03403  81 VGSLTLPASWNSPFKTGEKYPLIVFSHGLGAFRTIYSAICIELASHGFVVAAVEHRDRSASATYFFKDKPAAEEEQKSWI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   204 YLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALS 283
Cdd:pfam03403 161 YLRKVKEEEEFHLRNEQVQQRAQECSKALSLILDINLGTPVENVLDSDFDWQQLKGNLDMSKIAVIGHSFGGATVIQSLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   284 EDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKI 363
Cdd:pfam03403 241 EDTRFRCGIALDAWMFPVGDDVYSKARQPLLFINSEKFQWAEDIFKMKKIYSPDKESKMITIKGSVHQNFSDFTFVTGKI 320
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 14715116   364 IGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENL 415
Cdd:pfam03403 321 IGKKLKLKGEIDPYEAIDINNRASLAFLQKHLDLHKDFDQWDNLIEGDDENL 372
Abhydrolase_6 pfam12697
Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse ...
240-360 1.43e-03

Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse specificity.


:

Pssm-ID: 289467 [Multi-domain]  Cd Length: 207  Bit Score: 38.65  E-value: 1.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   240 HGDPKENVLGSAfDMKQLKDAIDE----TKIALMGHSFGGATVLQALsedqrFRCGVALDPWMYPVNEELYSRTLQPLLF 315
Cdd:pfam12697  33 HGSSDRPPYDLA-DLADLAALLAAlgaaGPVVLVGHSLGGAVALAAA-----LVVGVLLAPLGAPLGLAAALLALLAALA 106
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 14715116   316 INSAKFQTPKDIAKmKKFYQPDKERKMITIKGSVHQNFDDFTFVT 360
Cdd:pfam12697 107 PALAAPRWLRELLA-RAFLDDLPDAAWAAALAALAALLAALALLT 150
 
Name Accession Description Interval E-value
PAF-AH_p_II pfam03403
Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor ...
47-415 0e+00

Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.


Pssm-ID: 251925  Cd Length: 372  Bit Score: 665.68  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116    47 AAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQ--DQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNIL-HLL 123
Cdd:pfam03403   1 AGSSGQVKIPAGNGPYPVGCTDLMIGHTLRGSFLRLYYPSDqaDEDREDTLWIPNKEYFQGLSEFLGTSSWLGNRLfALL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   124 YGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWL 203
Cdd:pfam03403  81 VGSLTLPASWNSPFKTGEKYPLIVFSHGLGAFRTIYSAICIELASHGFVVAAVEHRDRSASATYFFKDKPAAEEEQKSWI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   204 YLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALS 283
Cdd:pfam03403 161 YLRKVKEEEEFHLRNEQVQQRAQECSKALSLILDINLGTPVENVLDSDFDWQQLKGNLDMSKIAVIGHSFGGATVIQSLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   284 EDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKI 363
Cdd:pfam03403 241 EDTRFRCGIALDAWMFPVGDDVYSKARQPLLFINSEKFQWAEDIFKMKKIYSPDKESKMITIKGSVHQNFSDFTFVTGKI 320
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 14715116   364 IGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENL 415
Cdd:pfam03403 321 IGKKLKLKGEIDPYEAIDINNRASLAFLQKHLDLHKDFDQWDNLIEGDDENL 372
COG4188 COG4188
Predicted dienelactone hydrolase [General function prediction only];
129-282 9.51e-10

Predicted dienelactone hydrolase [General function prediction only];


Pssm-ID: 226651  Cd Length: 365  Bit Score: 58.62  E-value: 9.51e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116 129 TPASWNSpLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEH-RDRS--ASATYFFEDQVAakvENRSWlyl 205
Cdd:COG4188  58 LPQGGTG-TVALYLLPLVVLSHGSGSYVTGFAWLAEHLASYGFVVAAPDHpGSNAggAPAAYAGPGSYA---PAEWW--- 130
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 14715116 206 rkvkqeesesvrkeqvqQRAIECSRALSAILDIEHGDpkenvlgsafdmkQLKDAIDETKIALMGHSFGGATVLQAL 282
Cdd:COG4188 131 -----------------ERPLDISALLDALLQLTASP-------------ALAGRLDPQRVGVLGHSFGGYTAMELA 177
PLN00021 PLN00021
chlorophyllase
142-296 6.51e-04

chlorophyllase


Pssm-ID: 177659  Cd Length: 313  Bit Score: 40.03  E-value: 6.51e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  142 KYPLIVFSHGLGAFRTIYSAIGIGLASNGFI-VATVEHRDRSASATYFFEDqvAAKVENrsWLylrkvkqeesesvrkeq 220
Cdd:PLN00021  51 TYPVLLFLHGYLLYNSFYSQLLQHIASHGFIvVAPQLYTLAGPDGTDEIKD--AAAVIN--WL----------------- 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  221 vqqraiecSRALSAILdiehgdpKENVLGsafdmkqlkdaiDETKIALMGHSFGGATV------LQALSEDQRFRCGVAL 294
Cdd:PLN00021 110 --------SSGLAAVL-------PEGVRP------------DLSKLALAGHSRGGKTAfalalgKAAVSLPLKFSALIGL 162

                 ..
gi 14715116  295 DP 296
Cdd:PLN00021 163 DP 164
DAP2 COG1506
Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism];
82-294 1.68e-05

Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism];


Pssm-ID: 224423 [Multi-domain]  Cd Length: 620  Bit Score: 45.60  E-value: 1.68e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  82 LYYPAQDQGRLDTvwIPNKEYFLGLSifLGTPSIV---GNILHLLYGSLTTPAswnsPLRTGEKYPLIVFSHG--LGAFR 156
Cdd:COG1506 338 IYLYDRGEEAKLT--SSNNSGLKKVK--LAEPEPVtykSNDGETIHGWLYKPP----GFDPRKKYPLIVYIHGgpSAQVG 409
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116 157 TIYSAIGIGLASNGFIVATVEHRdrsASATYffedqvaakveNRSWLylrkvkqeesesvrkeqvqqRAIECSRALSAIL 236
Cdd:COG1506 410 YSFNPEIQVLASAGYAVLAPNYR---GSTGY-----------GREFA--------------------DAIRGDWGGVDLE 455
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 14715116 237 DIEhgdpkenvlgSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVAL 294
Cdd:COG1506 456 DLI----------AAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTPRFKAAVAV 503
Abhydrolase_1 pfam00561
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
253-300 7.30e-05

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 278959 [Multi-domain]  Cd Length: 245  Bit Score: 42.87  E-value: 7.30e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 14715116   253 DMKQLKDAIDETKIALMGHSFGGATVLQALSE-DQRFRCGVALDPWMYP 300
Cdd:pfam00561  58 DLEAILDALGLEKVNLVGHSMGGLIALAYAAKyPDRVKALVLVGAILPP 106
Abhydrolase_6 pfam12697
Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse ...
240-360 1.43e-03

Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse specificity.


Pssm-ID: 289467 [Multi-domain]  Cd Length: 207  Bit Score: 38.65  E-value: 1.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   240 HGDPKENVLGSAfDMKQLKDAIDE----TKIALMGHSFGGATVLQALsedqrFRCGVALDPWMYPVNEELYSRTLQPLLF 315
Cdd:pfam12697  33 HGSSDRPPYDLA-DLADLAALLAAlgaaGPVVLVGHSLGGAVALAAA-----LVVGVLLAPLGAPLGLAAALLALLAALA 106
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 14715116   316 INSAKFQTPKDIAKmKKFYQPDKERKMITIKGSVHQNFDDFTFVT 360
Cdd:pfam12697 107 PALAAPRWLRELLA-RAFLDDLPDAAWAAALAALAALLAALALLT 150
 
Name Accession Description Interval E-value
PAF-AH_p_II pfam03403
Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor ...
47-415 0e+00

Platelet-activating factor acetylhydrolase, isoform II; Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.


Pssm-ID: 251925  Cd Length: 372  Bit Score: 665.68  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116    47 AAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQ--DQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNIL-HLL 123
Cdd:pfam03403   1 AGSSGQVKIPAGNGPYPVGCTDLMIGHTLRGSFLRLYYPSDqaDEDREDTLWIPNKEYFQGLSEFLGTSSWLGNRLfALL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   124 YGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWL 203
Cdd:pfam03403  81 VGSLTLPASWNSPFKTGEKYPLIVFSHGLGAFRTIYSAICIELASHGFVVAAVEHRDRSASATYFFKDKPAAEEEQKSWI 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   204 YLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALS 283
Cdd:pfam03403 161 YLRKVKEEEEFHLRNEQVQQRAQECSKALSLILDINLGTPVENVLDSDFDWQQLKGNLDMSKIAVIGHSFGGATVIQSLS 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   284 EDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKI 363
Cdd:pfam03403 241 EDTRFRCGIALDAWMFPVGDDVYSKARQPLLFINSEKFQWAEDIFKMKKIYSPDKESKMITIKGSVHQNFSDFTFVTGKI 320
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 14715116   364 IGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENL 415
Cdd:pfam03403 321 IGKKLKLKGEIDPYEAIDINNRASLAFLQKHLDLHKDFDQWDNLIEGDDENL 372
Abhydrolase_5 pfam12695
Alpha/beta hydrolase family; This family contains a diverse range of alpha/beta hydrolase ...
145-350 2.09e-13

Alpha/beta hydrolase family; This family contains a diverse range of alpha/beta hydrolase enzymes.


Pssm-ID: 289465  Cd Length: 146  Bit Score: 66.98  E-value: 2.09e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   145 LIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVEnrswlylrkvkqeesesvrkeqvqqr 224
Cdd:pfam12695   1 LVVLLHGAGGDPEAYAPLARALASRGYNVVAVDYPGHGASLGAPDAEAVLADAA-------------------------- 54
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   225 aiecsralsaildiehgdpkenvlgsafdmkqLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPwmYPVNEE 304
Cdd:pfam12695  55 --------------------------------ALLPIDPERIVLVGHSLGGGVALLLAARDPRVKGVVLLAP--YPDTDD 100
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 14715116   305 LYSRTLqPLLFINSAK--FQTPKDIAKMKKFYQPDKErkMITIKGSVH 350
Cdd:pfam12695 101 LAKLTV-PVLIIHGTRdgVVPPEEAEALAAALPGPAE--LVVIEGAGH 145
COG4188 COG4188
Predicted dienelactone hydrolase [General function prediction only];
129-282 9.51e-10

Predicted dienelactone hydrolase [General function prediction only];


Pssm-ID: 226651  Cd Length: 365  Bit Score: 58.62  E-value: 9.51e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116 129 TPASWNSpLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEH-RDRS--ASATYFFEDQVAakvENRSWlyl 205
Cdd:COG4188  58 LPQGGTG-TVALYLLPLVVLSHGSGSYVTGFAWLAEHLASYGFVVAAPDHpGSNAggAPAAYAGPGSYA---PAEWW--- 130
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 14715116 206 rkvkqeesesvrkeqvqQRAIECSRALSAILDIEHGDpkenvlgsafdmkQLKDAIDETKIALMGHSFGGATVLQAL 282
Cdd:COG4188 131 -----------------ERPLDISALLDALLQLTASP-------------ALAGRLDPQRVGVLGHSFGGYTAMELA 177
Peptidase_S9 pfam00326
Prolyl oligopeptidase family;
261-296 1.92e-05

Prolyl oligopeptidase family;


Pssm-ID: 278741  Cd Length: 213  Bit Score: 44.14  E-value: 1.92e-05
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 14715116   261 IDETKIALMGHSFGGATVLQAL-SEDQRFRCGVALDP 296
Cdd:pfam00326  61 TDPDRLAIWGGSYGGYLTGAALnQRPDLFKAAVAHVP 97
PLN00021 PLN00021
chlorophyllase
142-296 6.51e-04

chlorophyllase


Pssm-ID: 177659  Cd Length: 313  Bit Score: 40.03  E-value: 6.51e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  142 KYPLIVFSHGLGAFRTIYSAIGIGLASNGFI-VATVEHRDRSASATYFFEDqvAAKVENrsWLylrkvkqeesesvrkeq 220
Cdd:PLN00021  51 TYPVLLFLHGYLLYNSFYSQLLQHIASHGFIvVAPQLYTLAGPDGTDEIKD--AAAVIN--WL----------------- 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  221 vqqraiecSRALSAILdiehgdpKENVLGsafdmkqlkdaiDETKIALMGHSFGGATV------LQALSEDQRFRCGVAL 294
Cdd:PLN00021 110 --------SSGLAAVL-------PEGVRP------------DLSKLALAGHSRGGKTAfalalgKAAVSLPLKFSALIGL 162

                 ..
gi 14715116  295 DP 296
Cdd:PLN00021 163 DP 164
YbbA COG2819
Predicted hydrolase of the alpha/beta superfamily [General function prediction only];
251-296 3.20e-03

Predicted hydrolase of the alpha/beta superfamily [General function prediction only];


Pssm-ID: 225375  Cd Length: 264  Bit Score: 37.77  E-value: 3.20e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|...
gi 14715116 251 AFDMKQLKDAIDET------KIALMGHSFGGATVLQALSEDQR-FRCGVALDP 296
Cdd:COG2819 118 EFLTEQLKPFIEARyrtnseRTAIIGHSLGGLFVLFALLTYPDcFGRYGLISP 170
DAP2 COG1506
Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism];
82-294 1.68e-05

Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism];


Pssm-ID: 224423 [Multi-domain]  Cd Length: 620  Bit Score: 45.60  E-value: 1.68e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116  82 LYYPAQDQGRLDTvwIPNKEYFLGLSifLGTPSIV---GNILHLLYGSLTTPAswnsPLRTGEKYPLIVFSHG--LGAFR 156
Cdd:COG1506 338 IYLYDRGEEAKLT--SSNNSGLKKVK--LAEPEPVtykSNDGETIHGWLYKPP----GFDPRKKYPLIVYIHGgpSAQVG 409
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116 157 TIYSAIGIGLASNGFIVATVEHRdrsASATYffedqvaakveNRSWLylrkvkqeesesvrkeqvqqRAIECSRALSAIL 236
Cdd:COG1506 410 YSFNPEIQVLASAGYAVLAPNYR---GSTGY-----------GREFA--------------------DAIRGDWGGVDLE 455
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 14715116 237 DIEhgdpkenvlgSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVAL 294
Cdd:COG1506 456 DLI----------AAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTPRFKAAVAV 503
Abhydrolase_1 pfam00561
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
253-300 7.30e-05

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 278959 [Multi-domain]  Cd Length: 245  Bit Score: 42.87  E-value: 7.30e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 14715116   253 DMKQLKDAIDETKIALMGHSFGGATVLQALSE-DQRFRCGVALDPWMYP 300
Cdd:pfam00561  58 DLEAILDALGLEKVNLVGHSMGGLIALAYAAKyPDRVKALVLVGAILPP 106
Abhydrolase_6 pfam12697
Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse ...
240-360 1.43e-03

Alpha/beta hydrolase family; This family contains alpha/beta hydrolase enzymes of diverse specificity.


Pssm-ID: 289467 [Multi-domain]  Cd Length: 207  Bit Score: 38.65  E-value: 1.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14715116   240 HGDPKENVLGSAfDMKQLKDAIDE----TKIALMGHSFGGATVLQALsedqrFRCGVALDPWMYPVNEELYSRTLQPLLF 315
Cdd:pfam12697  33 HGSSDRPPYDLA-DLADLAALLAAlgaaGPVVLVGHSLGGAVALAAA-----LVVGVLLAPLGAPLGLAAALLALLAALA 106
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 14715116   316 INSAKFQTPKDIAKmKKFYQPDKERKMITIKGSVHQNFDDFTFVT 360
Cdd:pfam12697 107 PALAAPRWLRELLA-RAFLDDLPDAAWAAALAALAALLAALALLT 150
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH