NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|14149756|ref|NP_080306|]
View 

eukaryotic translation initiation factor 2 subunit 2 [Mus musculus]

Protein Classification

eIF2B_5 domain-containing protein (domain architecture ID 10652752)

eIF2B_5 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
197-306 1.28e-60

domain present in translation initiation factor eIF2B and eIF5;


:

Pssm-ID: 214764  Cd Length: 110  Bit Score: 192.46  E-value: 1.28e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756    197 KRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEY 276
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 14149756    277 VTCHTCRSPDTILQKDTRLYFLQCETCHSR 306
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
 
Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
197-306 1.28e-60

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 192.46  E-value: 1.28e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756    197 KRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEY 276
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 14149756    277 VTCHTCRSPDTILQKDTRLYFLQCETCHSR 306
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
193-306 4.00e-58

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homolog. The region contains a putative zinc binding C4 finger.


Pssm-ID: 307814  Cd Length: 115  Bit Score: 186.16  E-value: 4.00e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756   193 VAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRY 272
Cdd:pfam01873   2 VTDSFYRYKMPPPQVKREGKGKTVIVNFSEIAKALNRDPEHVLKYLLKELGTQGSIDENGRLIINGKFSAKQIEDLLDKY 81
                          90       100       110
                  ....*....|....*....|....*....|....
gi 14149756   273 IKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSR 306
Cdd:pfam01873  82 IEEYVLCPECGSPDTELIKENRLLFLKCEACGAR 115
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
168-322 2.59e-41

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 143.66  E-value: 2.59e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756 168 SERDYTYEELLNRVFnimrEKNPDMVAGEKRKFVMKPPQVVRVGtKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGS 247
Cdd:COG1601   2 SEMEDDYEELLERAY----SELPEKEVKNDERFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 14149756 248 IDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGK 322
Cdd:COG1601  77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
168-312 3.16e-40

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 140.43  E-value: 3.16e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756  168 SERDYTYEELLNRVFnimrEKNPDmVAGEKRKFVMKPPQVVRVGTKkTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGS 247
Cdd:PRK03988   1 MSDYYDYEELLDRAY----EKLPE-KVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGN 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 14149756  248 IDGNnQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASI 312
Cdd:PRK03988  75 IEGG-RLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
174-312 2.38e-22

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 91.45  E-value: 2.38e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756   174 YEELLNRVFnimrEKNPDMVAgEKRKFVMKPPQVVRVGTKkTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNnQ 253
Cdd:TIGR00311   2 YEKLLERAI----DQLPDEVF-ETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGG-R 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 14149756   254 LVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASI 312
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
 
Name Accession Description Interval E-value
eIF2B_5 smart00653
domain present in translation initiation factor eIF2B and eIF5;
197-306 1.28e-60

domain present in translation initiation factor eIF2B and eIF5;


Pssm-ID: 214764  Cd Length: 110  Bit Score: 192.46  E-value: 1.28e-60
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756    197 KRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEY 276
Cdd:smart00653   1 FYRFKMPPPQVLREGKGKTVIVNFADIAKALNRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEY 80
                           90       100       110
                   ....*....|....*....|....*....|
gi 14149756    277 VTCHTCRSPDTILQKDTRLYFLQCETCHSR 306
Cdd:smart00653  81 VLCPECGSPDTELIKENRLFFLKCEACGAR 110
eIF-5_eIF-2B pfam01873
Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of ...
193-306 4.00e-58

Domain found in IF2B/IF5; This family includes the N terminus of eIF-5, and the C terminus of eIF-2 beta. This region corresponds to the whole of the archaebacterial eIF-2 beta homolog. The region contains a putative zinc binding C4 finger.


Pssm-ID: 307814  Cd Length: 115  Bit Score: 186.16  E-value: 4.00e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756   193 VAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRY 272
Cdd:pfam01873   2 VTDSFYRYKMPPPQVKREGKGKTVIVNFSEIAKALNRDPEHVLKYLLKELGTQGSIDENGRLIINGKFSAKQIEDLLDKY 81
                          90       100       110
                  ....*....|....*....|....*....|....
gi 14149756   273 IKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSR 306
Cdd:pfam01873  82 IEEYVLCPECGSPDTELIKENRLLFLKCEACGAR 115
GCD7 COG1601
Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain ...
168-322 2.59e-41

Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224517  Cd Length: 151  Bit Score: 143.66  E-value: 2.59e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756 168 SERDYTYEELLNRVFnimrEKNPDMVAGEKRKFVMKPPQVVRVGtKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGS 247
Cdd:COG1601   2 SEMEDDYEELLERAY----SELPEKEVKNDERFRIPEPEINREG-NRTIIRNFGDIAEALNRDPEHLVKFLKKELGTAGS 76
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 14149756 248 IDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGK 322
Cdd:COG1601  77 IDGKGRLVLQGKFSDSEIVNEIERYIAEYVKCKECGSPDTELIKEERLLFLKCEACGAIRPVKLMKEYNLDFVSA 151
PRK03988 PRK03988
translation initiation factor IF-2 subunit beta; Validated
168-312 3.16e-40

translation initiation factor IF-2 subunit beta; Validated


Pssm-ID: 235189  Cd Length: 138  Bit Score: 140.43  E-value: 3.16e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756  168 SERDYTYEELLNRVFnimrEKNPDmVAGEKRKFVMKPPQVVRVGTKkTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGS 247
Cdd:PRK03988   1 MSDYYDYEELLDRAY----EKLPE-KVFKESRFEVPKPDVRIEGNR-TIIRNFKEIADRLNRDPKHVAKFLLKELGTAGN 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 14149756  248 IDGNnQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASI 312
Cdd:PRK03988  75 IEGG-RLILQGKFSPRVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGAETPVKPL 138
PRK12336 PRK12336
translation initiation factor IF-2 subunit beta; Provisional
172-314 1.05e-29

translation initiation factor IF-2 subunit beta; Provisional


Pssm-ID: 183451  Cd Length: 201  Bit Score: 114.27  E-value: 1.05e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756  172 YTYEELLNRVFNIMreknPDMVAGEKRkFVMKPPQVVRVGtKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGN 251
Cdd:PRK12336   1 MDYESLLDRAMEVL----PEPTKSGER-FSIPEPKIFIEG-KTTILTNFGEIADALNRDPDHLMKFLQRELGTAGKIEGG 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 14149756  252 nQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKT 314
Cdd:PRK12336  75 -RAVFNGKFTEEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRKA 136
aIF-2beta TIGR00311
translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high ...
174-312 2.38e-22

translation initiation factor aIF-2, beta subunit, putative; The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]


Pssm-ID: 129411  Cd Length: 133  Bit Score: 91.45  E-value: 2.38e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14149756   174 YEELLNRVFnimrEKNPDMVAgEKRKFVMKPPQVVRVGTKkTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNnQ 253
Cdd:TIGR00311   2 YEKLLERAI----DQLPDEVF-ETKRFEVPKAYIVIEGNR-TIIQNFREVAKALNRDEQHLLKYLLKELGTAGNLEGG-R 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 14149756   254 LVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASI 312
Cdd:TIGR00311  75 LILQGKFTHFLLNERIEDYVRKYVICRECNRPDTRIIKEGRVSLLKCEACGAKAPLRNI 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH