NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|139472848|ref|YP_001129410|]
View 

ORF57 [Human gammaherpesvirus 8]

Protein Classification

Herpes_UL69 domain-containing protein (domain architecture ID 10527204)

Herpes_UL69 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Herpes_UL69 pfam05459
Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are ...
236-453 1.98e-77

Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are transcriptional regulator proteins.


:

Pssm-ID: 310217  Cd Length: 214  Bit Score: 243.81  E-value: 1.98e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  236 LINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKdiDIILDTA 315
Cdd:pfam05459   1 LHNKLISWEYLLRYGKQLRTFLTRPRNKSLWVAMRFEVIRNEGLITLLAFADETLTWLKLHLLHNLPLNPH--DPILSTA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  316 IFVCNAFVTRFRLLhLSCVFDKQSELALikqVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISAR 395
Cdd:pfam05459  79 GAVLFNLFTKLRPL-LSCLLDNRGQGAL---VCYILCGLCRLPELVRRLRPSDIKDPLTLLLAYAARFARVVHRRRRTLR 154
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 139472848  396 GQELFRT---LLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSaKFNKGLFFYP 453
Cdd:pfam05459 155 GTKLPGYirdFLEEYRPGACMALLNEALDTHTRECRSEECELLIRAILGP-QYTHGLFFCP 214
 
Name Accession Description Interval E-value
Herpes_UL69 pfam05459
Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are ...
236-453 1.98e-77

Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are transcriptional regulator proteins.


Pssm-ID: 310217  Cd Length: 214  Bit Score: 243.81  E-value: 1.98e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  236 LINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKdiDIILDTA 315
Cdd:pfam05459   1 LHNKLISWEYLLRYGKQLRTFLTRPRNKSLWVAMRFEVIRNEGLITLLAFADETLTWLKLHLLHNLPLNPH--DPILSTA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  316 IFVCNAFVTRFRLLhLSCVFDKQSELALikqVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISAR 395
Cdd:pfam05459  79 GAVLFNLFTKLRPL-LSCLLDNRGQGAL---VCYILCGLCRLPELVRRLRPSDIKDPLTLLLAYAARFARVVHRRRRTLR 154
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 139472848  396 GQELFRT---LLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSaKFNKGLFFYP 453
Cdd:pfam05459 155 GTKLPGYirdFLEEYRPGACMALLNEALDTHTRECRSEECELLIRAILGP-QYTHGLFFCP 214
 
Name Accession Description Interval E-value
Herpes_UL69 pfam05459
Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are ...
236-453 1.98e-77

Herpesvirus transcriptional regulator family; This family includes UL69 and IE63 that are transcriptional regulator proteins.


Pssm-ID: 310217  Cd Length: 214  Bit Score: 243.81  E-value: 1.98e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  236 LINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKdiDIILDTA 315
Cdd:pfam05459   1 LHNKLISWEYLLRYGKQLRTFLTRPRNKSLWVAMRFEVIRNEGLITLLAFADETLTWLKLHLLHNLPLNPH--DPILSTA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139472848  316 IFVCNAFVTRFRLLhLSCVFDKQSELALikqVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISAR 395
Cdd:pfam05459  79 GAVLFNLFTKLRPL-LSCLLDNRGQGAL---VCYILCGLCRLPELVRRLRPSDIKDPLTLLLAYAARFARVVHRRRRTLR 154
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 139472848  396 GQELFRT---LLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSaKFNKGLFFYP 453
Cdd:pfam05459 155 GTKLPGYirdFLEEYRPGACMALLNEALDTHTRECRSEECELLIRAILGP-QYTHGLFFCP 214
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH