NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13518021|ref|NP_078613|]
View 

protein Wnt-2b isoform WNT-2B2 [Homo sapiens]

Protein Classification

wnt domain-containing protein (domain architecture ID 10443547)

wnt domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
74-380 0e+00

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


:

Pssm-ID: 306592  Cd Length: 304  Bit Score: 510.93  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGKVLKRGTRETAFVYAISSAGVVHA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   154 ITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFL 233
Cdd:pfam00110  81 VTRACSSGELTSCGCDRSPRGRSPG--EDWEWGGCSDNIDYGMRFSRKFLDARERKGRDARALMNLHNNEAGRKAVKKNM 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMaTQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDK 313
Cdd:pfam00110 159 RRECKCHGVSGSCSVKTCWKQLPDFREVGDRLKEKYDGAVKVV-NNRGTRLRPRNSRFKPPTKTDLVYLEKSPDYCERDP 237
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 13518021   314 AAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 238 KLGSLGTQGRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
74-380 0e+00

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 306592  Cd Length: 304  Bit Score: 510.93  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGKVLKRGTRETAFVYAISSAGVVHA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   154 ITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFL 233
Cdd:pfam00110  81 VTRACSSGELTSCGCDRSPRGRSPG--EDWEWGGCSDNIDYGMRFSRKFLDARERKGRDARALMNLHNNEAGRKAVKKNM 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMaTQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDK 313
Cdd:pfam00110 159 RRECKCHGVSGSCSVKTCWKQLPDFREVGDRLKEKYDGAVKVV-NNRGTRLRPRNSRFKPPTKTDLVYLEKSPDYCERDP 237
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 13518021   314 AAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 238 KLGSLGTQGRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
WNT1 smart00097
found in Wnt-1;
74-380 5.27e-158

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 451.00  E-value: 5.27e-158
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021     74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLD-NASVFGKVLRQGTRETAFVYAISSAGVAHA 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    154 ITRACSQGELSVCSCDPYTRGRhhDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVRRFL 233
Cdd:smart00097  80 VTRACSEGELDSCGCDYRKRGR--AGGRGWKWGGCSDNIDFGIRFSREFVDARERG-KDARALMNLHNNEAGRLAVKKTM 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQG--YRRATRTDLVYFDNSPDYCVL 311
Cdd:smart00097 157 KRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEVEVDKRGTNKAPVPKNstFKPPTETDLVYLESSPDFCEK 236
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 13518021    312 DKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:smart00097 237 NPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
74-380 0e+00

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 306592  Cd Length: 304  Bit Score: 510.93  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:pfam00110   1 RLPGLSRRQRRLCRRNPDVMASIAEGARLAISECQHQFRNRRWNCSTLEDRNAVFGKVLKRGTRETAFVYAISSAGVVHA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   154 ITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFL 233
Cdd:pfam00110  81 VTRACSSGELTSCGCDRSPRGRSPG--EDWEWGGCSDNIDYGMRFSRKFLDARERKGRDARALMNLHNNEAGRKAVKKNM 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021   234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMaTQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDK 313
Cdd:pfam00110 159 RRECKCHGVSGSCSVKTCWKQLPDFREVGDRLKEKYDGAVKVV-NNRGTRLRPRNSRFKPPTKTDLVYLEKSPDYCERDP 237
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 13518021   314 AAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 238 KLGSLGTQGRECNKTSTGPDGCDLLCCGRGYNTRTVTRTERCNCKFHWCCYVKCKTCTRTVEVHTCK 304
WNT1 smart00097
found in Wnt-1;
74-380 5.27e-158

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 451.00  E-value: 5.27e-158
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021     74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLD-NASVFGKVLRQGTRETAFVYAISSAGVAHA 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    154 ITRACSQGELSVCSCDPYTRGRhhDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVRRFL 233
Cdd:smart00097  80 VTRACSEGELDSCGCDYRKRGR--AGGRGWKWGGCSDNIDFGIRFSREFVDARERG-KDARALMNLHNNEAGRLAVKKTM 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13518021    234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQG--YRRATRTDLVYFDNSPDYCVL 311
Cdd:smart00097 157 KRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEVEVDKRGTNKAPVPKNstFKPPTETDLVYLESSPDFCEK 236
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 13518021    312 DKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:smart00097 237 NPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH