NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13364212|dbj|BAB38159|]
View 

adenylate cyclase [Escherichia coli O157:H7 str. Sakai]

Protein Classification

CBM6_cellulase-like and RICIN domain-containing protein (domain architecture ID 11459653)

protein containing domains GH99_GH71_like, CBM6_cellulase-like, RICIN, and Por_Secre_tail

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CyaA COG3072
Adenylate cyclase [Nucleotide transport and metabolism];
1-848 0e+00

Adenylate cyclase [Nucleotide transport and metabolism];


:

Pssm-ID: 225614  Cd Length: 853  Bit Score: 1555.91  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   1 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNEL-EL 79
Cdd:COG3072   1 MYLYLETLKQRLDALNQLRVERALAAMGPAFQRVLSLLPLLLHINHPLLPGYLDGNVPAGICLFTADDYQKQYLAEAqEL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  80 YRGMSVQDP--PKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLID 157
Cdd:COG3072  81 YRGMSLLPSrqPKGELPILGVYTMGSTSSIGQSCSSDLDIWVCHQDWLSTEERQLLQRKCSLLEDWAASQGVEVNFFLID 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 158 ENRFR-HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLS 236
Cdd:COG3072 161 ENRFRqHNESGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRLLWLMVPPEEEEHYDDYVMTLYAQGVITPNEWLDLGGLS 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 237 SLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAI 316
Cdd:COG3072 241 QLSAEEYFGASLWQLYKSIDSPYKSVLKTLLLEAYSWEYPNTRLLARDFKERLHAGELVSFGLDPYCMMLERVTRYLTAI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 317 EDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRN 396
Cdd:COG3072 321 EDFTRLDLVRRCFYLKVCEKLSREQACNGWRREVLEQLVSEWGWSAARLAELDNRANWKIKQVKEAHNELLDALMLSYRN 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 397 LIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESI 476
Cdd:COG3072 401 LIRFARRNNLSSSISPQDIGVLTRKLYAAFEALPGKVTLLNPQISPDLSEPNLTFIEVPAGRANKDGWYLYNQAPNAHSI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 477 ISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIV 556
Cdd:COG3072 481 ISHQPLEYNEYLNKLVAWAYFNGLLTSRTRLHIKSNGNVDLPKLQEMVTDLRQHFPLRLAAPTPKDLLSPCEIRSLAIIV 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 557 NLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDS 636
Cdd:COG3072 561 NLEVDPTSKFRQVVVHFDFRKLDVFSFGEVQNCLVGSIDLLYRNSWNEVRTLHFEGPQAMLEALKTILGKMHQGAPPPDS 640
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 637 VEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRfKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLH 716
Cdd:COG3072 641 VQVFCYSQHLRGLIRTRVQQLVSECISLRLGSTRQPTGR-KALRVSGQTWGLFFERRGVSVQKLENAVEFYGALSTNKLD 719
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 717 GLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDeNGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDR--- 793
Cdd:COG3072 720 GLSVQVEDNHRKLPPVVDGFASEGIIQFFFEDTSE-KSFNIYILDESNRVEVYRHCEGSKEELVRDVNRFYQSSHDRrna 798
                       810       820       830       840       850
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13364212 794 FTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDTPLLQQYFS 848
Cdd:COG3072 799 NTYGSSFINFNLPQFYQLLKNDGRVQVVPFRTRSAMNGPPANQDHDEPLLQQYFS 853
 
Name Accession Description Interval E-value
CyaA COG3072
Adenylate cyclase [Nucleotide transport and metabolism];
1-848 0e+00

Adenylate cyclase [Nucleotide transport and metabolism];


Pssm-ID: 225614  Cd Length: 853  Bit Score: 1555.91  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   1 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNEL-EL 79
Cdd:COG3072   1 MYLYLETLKQRLDALNQLRVERALAAMGPAFQRVLSLLPLLLHINHPLLPGYLDGNVPAGICLFTADDYQKQYLAEAqEL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  80 YRGMSVQDP--PKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLID 157
Cdd:COG3072  81 YRGMSLLPSrqPKGELPILGVYTMGSTSSIGQSCSSDLDIWVCHQDWLSTEERQLLQRKCSLLEDWAASQGVEVNFFLID 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 158 ENRFR-HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLS 236
Cdd:COG3072 161 ENRFRqHNESGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRLLWLMVPPEEEEHYDDYVMTLYAQGVITPNEWLDLGGLS 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 237 SLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAI 316
Cdd:COG3072 241 QLSAEEYFGASLWQLYKSIDSPYKSVLKTLLLEAYSWEYPNTRLLARDFKERLHAGELVSFGLDPYCMMLERVTRYLTAI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 317 EDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRN 396
Cdd:COG3072 321 EDFTRLDLVRRCFYLKVCEKLSREQACNGWRREVLEQLVSEWGWSAARLAELDNRANWKIKQVKEAHNELLDALMLSYRN 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 397 LIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESI 476
Cdd:COG3072 401 LIRFARRNNLSSSISPQDIGVLTRKLYAAFEALPGKVTLLNPQISPDLSEPNLTFIEVPAGRANKDGWYLYNQAPNAHSI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 477 ISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIV 556
Cdd:COG3072 481 ISHQPLEYNEYLNKLVAWAYFNGLLTSRTRLHIKSNGNVDLPKLQEMVTDLRQHFPLRLAAPTPKDLLSPCEIRSLAIIV 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 557 NLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDS 636
Cdd:COG3072 561 NLEVDPTSKFRQVVVHFDFRKLDVFSFGEVQNCLVGSIDLLYRNSWNEVRTLHFEGPQAMLEALKTILGKMHQGAPPPDS 640
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 637 VEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRfKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLH 716
Cdd:COG3072 641 VQVFCYSQHLRGLIRTRVQQLVSECISLRLGSTRQPTGR-KALRVSGQTWGLFFERRGVSVQKLENAVEFYGALSTNKLD 719
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 717 GLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDeNGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDR--- 793
Cdd:COG3072 720 GLSVQVEDNHRKLPPVVDGFASEGIIQFFFEDTSE-KSFNIYILDESNRVEVYRHCEGSKEELVRDVNRFYQSSHDRrna 798
                       810       820       830       840       850
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13364212 794 FTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDTPLLQQYFS 848
Cdd:COG3072 799 NTYGSSFINFNLPQFYQLLKNDGRVQVVPFRTRSAMNGPPANQDHDEPLLQQYFS 853
cyaA PRK09450
adenylate cyclase; Provisional
1-824 0e+00

adenylate cyclase; Provisional


Pssm-ID: 236522  Cd Length: 830  Bit Score: 1480.93  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212    1 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNELELY 80
Cdd:PRK09450   1 MRKYLETLKQRLDALNQLRLARALAALSPAFQQVLSLLPLLLHVNHPLLPGYVSGNTPAGICNFTPDETQLAYLQRLELS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   81 RGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLIDENR 160
Cdd:PRK09450  81 FGYSVQDPPKGELPITGLYTMGSTGSIGQSESSDLDIWVCHRPWLDAEERQLLQRKCSLLEQWAASLGVEVNFFLMDEER 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  161 FRHNESGS-LGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLS 239
Cdd:PRK09450 161 FRHNESGSaLGGEDCGSTQHILLLDEFYRTAIRLAGKRPLWWLVPVEEEEHYDDYVMTLYSKGFLNPNEWLDLGGLSSLP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  240 AEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDF 319
Cdd:PRK09450 241 AEEYFGASLWQLYKGIDSPYKSVLKLLLLEAYSSEYPNTQLLSLDFKQRLLAGEIDSDGLDPYCLMLERVTRYLTAINDP 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  320 TRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIR 399
Cdd:PRK09450 321 TRLELVRRCFYLKVGEKLSRERACVGWRRELLSQLVSEWGWDEERLALLDNRANWKIGQVREFHNELVDALMQSYRNLIR 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  400 FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISH 479
Cdd:PRK09450 401 FARRNNLSSSISPQDIGILTRKLYAAFERLPGKVTLLNPQISPDLSEPDLTFIEVPPGRANRSGWYLYNQAPDPDSIIGH 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  480 QPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGN-GIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIVNL 558
Cdd:PRK09450 481 QPLEYNRYLNKLVAWAYFNGLLTSSTRLHLKGNgSDLDLAKLQELVADLRQHFPLRLPAPTPQALLQPCEIRHLLIIVNL 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  559 EYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVE 638
Cdd:PRK09450 561 EVDPTAHLRGQVVHFDFRNLDVFSFGGEQENLVGSVDLIYRNSWNEVRTLHFEGEQALLDALKTILGKMHQDAAPPPSVE 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  639 VFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGrfKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGL 718
Cdd:PRK09450 641 VFCYSQHLRGLIRTRVQQLVSECIELRLGSTRQEPG--KALRVAGQTWGLFFERLGVSVQKLENAVEFYGALSENKLHGL 718
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  719 SVQVETNHVKLPAVVDGFASEGIIQFFFEetQDENGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGS 798
Cdd:PRK09450 719 PVQLDTNFLKLPAVVDGFASEGIIQFFFE--DNEDGFNVYILDESNRLEHYHHCEGSKEELVRDVSRFYSSSHDRFTYGS 796
                        810       820
                 ....*....|....*....|....*.
gi 13364212  799 SFINFNLPQFYQIVKVDGREQVIPFR 824
Cdd:PRK09450 797 SFINFNLPQFYQLVRVDGRLQVIPFR 822
Adenylate_cycl pfam01295
Adenylate cyclase, class-I;
228-824 0e+00

Adenylate cyclase, class-I;


Pssm-ID: 307458  Cd Length: 600  Bit Score: 1016.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   228 EWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLE 307
Cdd:pfam01295   1 DWLDLGGLSALPANEYFGASLWQLYKGIDSPYKAVLKILLLEAYSSEYPNTRLLSMEFKQRLLAGDFVSYHFDPYLLMLE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   308 RVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERAC--VGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNE 385
Cdd:pfam01295  81 RVTDYLTKINDFKRLDLVRRCFYLKAGEGLSRLQPNgaKDWRRDKLQELVQQWGWSDELIQTLDNRRHWKIKQVKWANNQ 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   386 LLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWY 465
Cdd:pfam01295 161 LLELLMQSYRNLIQFARKNNISESISPEDIGILTRKLYTAFEELPGKVTLLNPQISPDLSEPDLTFIEVPEGSTNKAGWY 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   466 LYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGiVDLP--KLQEMVADVSHHFPLRLPAPTPKAL 543
Cdd:pfam01295 241 LYNQAPDSAYLSGRRPLEYNPSLIKLVAWAYFNGLLTEDTQLHIVSQG-VDLTsdKLRQFVTDLRLSFPVRAPKPTNLDL 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   544 YSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTI 623
Cdd:pfam01295 320 CHPCEIRHLVLIINLEQDPTQHWSLQEVPVDIQNADLFSFGRSQECLVGSVDLIYRNSWNEIRTLHFEGEEAILEALKTI 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   624 LGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSECIELRLsSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENA 703
Cdd:pfam01295 400 SNKIHRGSAPPESVDVFCYSRRLRSQIRNRVEQLVNRCIELRL-GTLQQRTQVKPLRVGGKNYGLFFERRGVSIQELENA 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   704 IEFYGAISHNKLHGLSVQVETNH--VKLPAVVDGFASEGIIQFFFEETqdENGFNIYILDESNRVEVYHHCEGSKEELVR 781
Cdd:pfam01295 479 VDFYGQISRNKLVELPRPELGDDpfLKIPAIIDEFASEGFLQFFFEDN--ENGFNVYILDEKNELEIYHHCDGSKEELVN 556
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|...
gi 13364212   782 DVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFR 824
Cdd:pfam01295 557 EINRFYASSESRKNTNSNIINFNLPQFYQLVRVDGELQIVPFG 599
 
Name Accession Description Interval E-value
CyaA COG3072
Adenylate cyclase [Nucleotide transport and metabolism];
1-848 0e+00

Adenylate cyclase [Nucleotide transport and metabolism];


Pssm-ID: 225614  Cd Length: 853  Bit Score: 1555.91  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   1 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNEL-EL 79
Cdd:COG3072   1 MYLYLETLKQRLDALNQLRVERALAAMGPAFQRVLSLLPLLLHINHPLLPGYLDGNVPAGICLFTADDYQKQYLAEAqEL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  80 YRGMSVQDP--PKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLID 157
Cdd:COG3072  81 YRGMSLLPSrqPKGELPILGVYTMGSTSSIGQSCSSDLDIWVCHQDWLSTEERQLLQRKCSLLEDWAASQGVEVNFFLID 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 158 ENRFR-HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLS 236
Cdd:COG3072 161 ENRFRqHNESGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRLLWLMVPPEEEEHYDDYVMTLYAQGVITPNEWLDLGGLS 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 237 SLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAI 316
Cdd:COG3072 241 QLSAEEYFGASLWQLYKSIDSPYKSVLKTLLLEAYSWEYPNTRLLARDFKERLHAGELVSFGLDPYCMMLERVTRYLTAI 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 317 EDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRN 396
Cdd:COG3072 321 EDFTRLDLVRRCFYLKVCEKLSREQACNGWRREVLEQLVSEWGWSAARLAELDNRANWKIKQVKEAHNELLDALMLSYRN 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 397 LIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESI 476
Cdd:COG3072 401 LIRFARRNNLSSSISPQDIGVLTRKLYAAFEALPGKVTLLNPQISPDLSEPNLTFIEVPAGRANKDGWYLYNQAPNAHSI 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 477 ISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIV 556
Cdd:COG3072 481 ISHQPLEYNEYLNKLVAWAYFNGLLTSRTRLHIKSNGNVDLPKLQEMVTDLRQHFPLRLAAPTPKDLLSPCEIRSLAIIV 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 557 NLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDS 636
Cdd:COG3072 561 NLEVDPTSKFRQVVVHFDFRKLDVFSFGEVQNCLVGSIDLLYRNSWNEVRTLHFEGPQAMLEALKTILGKMHQGAPPPDS 640
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 637 VEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRfKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLH 716
Cdd:COG3072 641 VQVFCYSQHLRGLIRTRVQQLVSECISLRLGSTRQPTGR-KALRVSGQTWGLFFERRGVSVQKLENAVEFYGALSTNKLD 719
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212 717 GLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDeNGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDR--- 793
Cdd:COG3072 720 GLSVQVEDNHRKLPPVVDGFASEGIIQFFFEDTSE-KSFNIYILDESNRVEVYRHCEGSKEELVRDVNRFYQSSHDRrna 798
                       810       820       830       840       850
                ....*....|....*....|....*....|....*....|....*....|....*
gi 13364212 794 FTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDTPLLQQYFS 848
Cdd:COG3072 799 NTYGSSFINFNLPQFYQLLKNDGRVQVVPFRTRSAMNGPPANQDHDEPLLQQYFS 853
cyaA PRK09450
adenylate cyclase; Provisional
1-824 0e+00

adenylate cyclase; Provisional


Pssm-ID: 236522  Cd Length: 830  Bit Score: 1480.93  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212    1 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNELELY 80
Cdd:PRK09450   1 MRKYLETLKQRLDALNQLRLARALAALSPAFQQVLSLLPLLLHVNHPLLPGYVSGNTPAGICNFTPDETQLAYLQRLELS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   81 RGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLIDENR 160
Cdd:PRK09450  81 FGYSVQDPPKGELPITGLYTMGSTGSIGQSESSDLDIWVCHRPWLDAEERQLLQRKCSLLEQWAASLGVEVNFFLMDEER 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  161 FRHNESGS-LGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLS 239
Cdd:PRK09450 161 FRHNESGSaLGGEDCGSTQHILLLDEFYRTAIRLAGKRPLWWLVPVEEEEHYDDYVMTLYSKGFLNPNEWLDLGGLSSLP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  240 AEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDF 319
Cdd:PRK09450 241 AEEYFGASLWQLYKGIDSPYKSVLKLLLLEAYSSEYPNTQLLSLDFKQRLLAGEIDSDGLDPYCLMLERVTRYLTAINDP 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  320 TRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIR 399
Cdd:PRK09450 321 TRLELVRRCFYLKVGEKLSRERACVGWRRELLSQLVSEWGWDEERLALLDNRANWKIGQVREFHNELVDALMQSYRNLIR 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  400 FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISH 479
Cdd:PRK09450 401 FARRNNLSSSISPQDIGILTRKLYAAFERLPGKVTLLNPQISPDLSEPDLTFIEVPPGRANRSGWYLYNQAPDPDSIIGH 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  480 QPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGN-GIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIVNL 558
Cdd:PRK09450 481 QPLEYNRYLNKLVAWAYFNGLLTSSTRLHLKGNgSDLDLAKLQELVADLRQHFPLRLPAPTPQALLQPCEIRHLLIIVNL 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  559 EYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVE 638
Cdd:PRK09450 561 EVDPTAHLRGQVVHFDFRNLDVFSFGGEQENLVGSVDLIYRNSWNEVRTLHFEGEQALLDALKTILGKMHQDAAPPPSVE 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  639 VFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGrfKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGL 718
Cdd:PRK09450 641 VFCYSQHLRGLIRTRVQQLVSECIELRLGSTRQEPG--KALRVAGQTWGLFFERLGVSVQKLENAVEFYGALSENKLHGL 718
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212  719 SVQVETNHVKLPAVVDGFASEGIIQFFFEetQDENGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGS 798
Cdd:PRK09450 719 PVQLDTNFLKLPAVVDGFASEGIIQFFFE--DNEDGFNVYILDESNRLEHYHHCEGSKEELVRDVSRFYSSSHDRFTYGS 796
                        810       820
                 ....*....|....*....|....*.
gi 13364212  799 SFINFNLPQFYQIVKVDGREQVIPFR 824
Cdd:PRK09450 797 SFINFNLPQFYQLVRVDGRLQVIPFR 822
Adenylate_cycl pfam01295
Adenylate cyclase, class-I;
228-824 0e+00

Adenylate cyclase, class-I;


Pssm-ID: 307458  Cd Length: 600  Bit Score: 1016.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   228 EWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLE 307
Cdd:pfam01295   1 DWLDLGGLSALPANEYFGASLWQLYKGIDSPYKAVLKILLLEAYSSEYPNTRLLSMEFKQRLLAGDFVSYHFDPYLLMLE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   308 RVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERAC--VGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNE 385
Cdd:pfam01295  81 RVTDYLTKINDFKRLDLVRRCFYLKAGEGLSRLQPNgaKDWRRDKLQELVQQWGWSDELIQTLDNRRHWKIKQVKWANNQ 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   386 LLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWY 465
Cdd:pfam01295 161 LLELLMQSYRNLIQFARKNNISESISPEDIGILTRKLYTAFEELPGKVTLLNPQISPDLSEPDLTFIEVPEGSTNKAGWY 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   466 LYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGiVDLP--KLQEMVADVSHHFPLRLPAPTPKAL 543
Cdd:pfam01295 241 LYNQAPDSAYLSGRRPLEYNPSLIKLVAWAYFNGLLTEDTQLHIVSQG-VDLTsdKLRQFVTDLRLSFPVRAPKPTNLDL 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   544 YSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTI 623
Cdd:pfam01295 320 CHPCEIRHLVLIINLEQDPTQHWSLQEVPVDIQNADLFSFGRSQECLVGSVDLIYRNSWNEIRTLHFEGEEAILEALKTI 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   624 LGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSECIELRLsSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENA 703
Cdd:pfam01295 400 SNKIHRGSAPPESVDVFCYSRRLRSQIRNRVEQLVNRCIELRL-GTLQQRTQVKPLRVGGKNYGLFFERRGVSIQELENA 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212   704 IEFYGAISHNKLHGLSVQVETNH--VKLPAVVDGFASEGIIQFFFEETqdENGFNIYILDESNRVEVYHHCEGSKEELVR 781
Cdd:pfam01295 479 VDFYGQISRNKLVELPRPELGDDpfLKIPAIIDEFASEGFLQFFFEDN--ENGFNVYILDEKNELEIYHHCDGSKEELVN 556
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|...
gi 13364212   782 DVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFR 824
Cdd:pfam01295 557 EINRFYASSESRKNTNSNIINFNLPQFYQLVRVDGELQIVPFG 599
Adenyl_cycl_N pfam12633
Adenylate cyclase NT domain;
5-200 3.13e-115

Adenylate cyclase NT domain;


Pssm-ID: 315329  Cd Length: 196  Bit Score: 352.21  E-value: 3.13e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212     5 IETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNELElyRGMS 84
Cdd:pfam12633   1 LETLKQRFDALNQLRLERALAALSPRQQHVLSLLPLLLHYNHPLLPGYVSGDTPCGICNFTPSDYQLALLDRLF--RSFS 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13364212    85 VQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLIDENRFRH- 163
Cdd:pfam12633  79 YKETKGREPPILGLYLMGSTGSIAQSASSDLDIWVCHRPDLDAEERQLLQRKCQLIEQWAASLGVEVHFFLMDEERFRSg 158
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 13364212   164 NESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILW 200
Cdd:pfam12633 159 NRSSSLTGESCGSAQHLLLLDEFYRTAIRLAGKRLLW 195
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH