NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|126723435|ref|NP_001075959|]
View 

interleukin-10 precursor [Equus caballus]

Protein Classification

IL10 domain-containing protein (domain architecture ID 10465045)

IL10 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IL10 pfam00726
Interleukin 10;
33-174 2.10e-102

Interleukin 10;


:

Pssm-ID: 279115  Cd Length: 142  Bit Score: 294.58  E-value: 2.10e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435   33 FPTSLPHMLHELRAAFSRVKTFFQMKDQLDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSL 112
Cdd:pfam00726   1 QPDSFPHMLRELRDAFSRVKTFFQTKDQLDNLLLTESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPEIKEHVNSL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 126723435  113 GEKLKTLRVRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTT 174
Cdd:pfam00726  81 GEKLKTLRLRLRRCHRFLPCENKSKAVEKVKNAFNKLQEKGVYKAMSEFDIFINYIETYMTI 142
 
Name Accession Description Interval E-value
IL10 pfam00726
Interleukin 10;
33-174 2.10e-102

Interleukin 10;


Pssm-ID: 279115  Cd Length: 142  Bit Score: 294.58  E-value: 2.10e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435   33 FPTSLPHMLHELRAAFSRVKTFFQMKDQLDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSL 112
Cdd:pfam00726   1 QPDSFPHMLRELRDAFSRVKTFFQTKDQLDNLLLTESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPEIKEHVNSL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 126723435  113 GEKLKTLRVRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTT 174
Cdd:pfam00726  81 GEKLKTLRLRLRRCHRFLPCENKSKAVEKVKNAFNKLQEKGVYKAMSEFDIFINYIETYMTI 142
IL10 smart00188
Interleukin-10 family; Interleukin-10 inhibits the synthesis of a number of cytokines, ...
37-173 8.14e-101

Interleukin-10 family; Interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells.


Pssm-ID: 128485  Cd Length: 137  Bit Score: 290.23  E-value: 8.14e-101
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435    37 LPHMLHELRAAFSRVKTFFQMKDQLDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 116
Cdd:smart00188   1 LPHMLRELRAAFSRVKTFFQMKDQLDNILLTESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 80
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 126723435   117 KTLRVRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMT 173
Cdd:smart00188  81 KTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGVYKAMSEFDIFINYIEAYMT 137
 
Name Accession Description Interval E-value
IL10 pfam00726
Interleukin 10;
33-174 2.10e-102

Interleukin 10;


Pssm-ID: 279115  Cd Length: 142  Bit Score: 294.58  E-value: 2.10e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435   33 FPTSLPHMLHELRAAFSRVKTFFQMKDQLDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSL 112
Cdd:pfam00726   1 QPDSFPHMLRELRDAFSRVKTFFQTKDQLDNLLLTESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPEIKEHVNSL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 126723435  113 GEKLKTLRVRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTT 174
Cdd:pfam00726  81 GEKLKTLRLRLRRCHRFLPCENKSKAVEKVKNAFNKLQEKGVYKAMSEFDIFINYIETYMTI 142
IL10 smart00188
Interleukin-10 family; Interleukin-10 inhibits the synthesis of a number of cytokines, ...
37-173 8.14e-101

Interleukin-10 family; Interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells.


Pssm-ID: 128485  Cd Length: 137  Bit Score: 290.23  E-value: 8.14e-101
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435    37 LPHMLHELRAAFSRVKTFFQMKDQLDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 116
Cdd:smart00188   1 LPHMLRELRAAFSRVKTFFQMKDQLDNILLTESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 80
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 126723435   117 KTLRVRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMT 173
Cdd:smart00188  81 KTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGVYKAMSEFDIFINYIEAYMT 137
IL22 pfam14565
Interleukin 22 IL-10-related T-cell-derived-inducible factor; Interleukin-22 is distantly ...
62-169 1.09e-06

Interleukin 22 IL-10-related T-cell-derived-inducible factor; Interleukin-22 is distantly related to interleukin (IL)-10, and is produced by activated T cells. IL-22 is a ligand for CRF2-4, a member of the class II cytokine receptor family.


Pssm-ID: 291245  Cd Length: 139  Bit Score: 45.73  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723435   62 DNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVM-PQAENHGPDIKEHVNSLGeklkTLRVRLRRCHRFLPCENKSKAVE 140
Cdd:pfam14565  32 DNRLIGEKIFHGIRENERCYLMKQILEFILEDVLfPEADEFQPYAEDVAPFLA----RLSNELSRCHIEGDDEHIEKNLE 107
                          90       100
                  ....*....|....*....|....*....
gi 126723435  141 QVKSAFSKLQEKGVYKAMSEFDIFINYIE 169
Cdd:pfam14565 108 ELKDKMKELGENGEIKAIGELDLLFDSIE 136
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH