NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|126723163|ref|NP_001075596|]
View 

solute carrier family 22 member 6 [Oryctolagus cuniculus]

Protein Classification

MFS transporter (domain architecture ID 11489935)

major facilitator superfamily (MFS) transporter facilitates the transport across cytoplasmic or internal membranes of one or more from a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-515 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 273328  Cd Length: 505  Bit Score: 662.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   11 GGVGRFQRIQVTLVVLPLLLMASHNTLQNFTAAIPPHHCRPPAHANLSKDGGLQAWLPQDTQGRPKSCLRFTSPQERPPF 90
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDAANLSSRCELNLTLPRLPDGRPESCLRFMVDQWANPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   91 LNGTEANGTGT-----TEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLGQSLYMAGVLIGAMVFGYLADRLGRRKVL 165
Cdd:TIGR00898  81 LLGCEPLKLSDlglaaTEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  166 ILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAYVGTLAGYVYSTGQFLLAGVAYAVP 245
Cdd:TIGR00898 161 LLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAYFIP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  246 HWRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQKVARINGKqeegaKLSMEVLRTNLQKELTMSKGQAS 325
Cdd:TIGR00898 241 DWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKKQYS 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  326 AMELLRCPALRHLFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLA 405
Cdd:TIGR00898 316 FLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAASLLLA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  406 GICILVNGVIPRDQSIVRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVSMTSELYPSL 485
Cdd:TIGR00898 396 GVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEKWLFL 475
                         490       500       510
                  ....*....|....*....|....*....|
gi 126723163  486 PLFIYGAVPVAASAATALLPETLGQPLPDT 515
Cdd:TIGR00898 476 PLVLFGGLALLAGILTLFLPETKGVPLPET 505
 
Name Accession Description Interval E-value
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-515 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328  Cd Length: 505  Bit Score: 662.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   11 GGVGRFQRIQVTLVVLPLLLMASHNTLQNFTAAIPPHHCRPPAHANLSKDGGLQAWLPQDTQGRPKSCLRFTSPQERPPF 90
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDAANLSSRCELNLTLPRLPDGRPESCLRFMVDQWANPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   91 LNGTEANGTGT-----TEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLGQSLYMAGVLIGAMVFGYLADRLGRRKVL 165
Cdd:TIGR00898  81 LLGCEPLKLSDlglaaTEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  166 ILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAYVGTLAGYVYSTGQFLLAGVAYAVP 245
Cdd:TIGR00898 161 LLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAYFIP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  246 HWRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQKVARINGKqeegaKLSMEVLRTNLQKELTMSKGQAS 325
Cdd:TIGR00898 241 DWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKKQYS 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  326 AMELLRCPALRHLFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLA 405
Cdd:TIGR00898 316 FLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAASLLLA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  406 GICILVNGVIPRDQSIVRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVSMTSELYPSL 485
Cdd:TIGR00898 396 GVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEKWLFL 475
                         490       500       510
                  ....*....|....*....|....*....|
gi 126723163  486 PLFIYGAVPVAASAATALLPETLGQPLPDT 515
Cdd:TIGR00898 476 PLVLFGGLALLAGILTLFLPETKGVPLPET 505
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
135-505 7.59e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392  Cd Length: 352  Bit Score: 111.64  E-value: 7.59e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 135 QLGQSLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWM 214
Cdd:cd06174   37 GLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWF 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 215 PIHTRAYVGTLAGYVYSTGQFLLAGVAYAVPH---WRYLQLLVSVPFFAFFVYSWFFIesarwystpgrldltlkalqkv 291
Cdd:cd06174  117 PPKERGRALGLFSAGFGLGALLGPLLGGLLAEslgWRWLFLILAILGLLLALLLLFLL---------------------- 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 292 aringkqeegaklsmevlrtnlqkeltmskgqasamellrcpalrHLFLCLSLLWFATSFAYYGLVMDLQGFGVS----- 366
Cdd:cd06174  175 ---------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLYLQEvlgls 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 367 ---IYLIQVIFGAVDLPAKLVCFLVINSLGRRP-AQMASLLLAGICILVNGVIPRDQSIVrtSLAVLGKGCLASSFNCIF 442
Cdd:cd06174  210 aaeAGLLLSLFGLGGILGALLGGLLSDRLGRRRlLLLIGLLLAALGLLLLALAPSLALLL--VALLLLGFGLGFAFPALL 287
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 126723163 443 LYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVS--MTSELYPSLPLFIYGAVPVAASAATALLP 505
Cdd:cd06174  288 TLASELAPPEARGTASGLFNTFGSLGGALGPLLAglLLDTGGYGGVFLILAALALLAALLLLLLP 352
Sugar_tr pfam00083
Sugar (and other) transporter;
139-512 1.80e-24

Sugar (and other) transporter;


Pssm-ID: 306568  Cd Length: 452  Bit Score: 106.20  E-value: 1.80e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSP---NFTVYCTFRLLSGMSLAGIALNCMTLNVEWMP 215
Cdd:pfam00083  53 SIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKgkwSVYQLIVGRVLVGIGVGGASVLAPMYISEIAP 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  216 IHTRAYVGTLAGYVYSTGQFLLAGVAYAVPH------WRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQ 289
Cdd:pfam00083 133 KKLRGALGSLYQLAITFGILLAYIFGLGLNKtsnsdgWRIPLGLQLVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLA 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  290 KvarINGkqEEGAKLSMEVLRTNLQKELTMSKgqASAMELLR-CPALRHLFLCLSLLWFA-----TSFAYYGLVMdLQGF 363
Cdd:pfam00083 213 K---LRG--VPDVDRELDEIKDSLEAGQEAEK--ASWKELFStKTRRQRLLIGVMLQIFQqltgiNAIFYYSTTI-FENL 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  364 GVSIYLIQ-VIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVNGVIPRDQ-------SIVRTSLAVLGKGCLA 435
Cdd:pfam00083 285 GLSDSFLVtIIVGVVNFVFTFIAIFLVDRFGRRPLLLLGAAGMAICFVILGIVALLGvsksdwaGIVAIVFIALFIAFFA 364
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  436 SSFNCI-FLYTGELYPTMIRQTGLGMGSTMARVGSIVsplvsmTSELYP----SLPLFIYGAVPVAASAATAL-----LP 505
Cdd:pfam00083 365 MGWGPVpWVIVSELFPLSVRSKAMALATAANWLANFL------IGFLFPiitdAIGLGYTFFIFAGLLVLFIIfvfffVP 438

                  ....*..
gi 126723163  506 ETLGQPL 512
Cdd:pfam00083 439 ETKGRTL 445
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
139-202 1.17e-07

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371  Cd Length: 394  Bit Score: 53.77  E-value: 1.17e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 126723163 139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGI 202
Cdd:COG2814   55 TAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAPSFAVLLLARALAGLAHGVF 118
PRK03893 PRK03893
putative sialic acid transporter; Provisional
139-262 1.41e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668  Cd Length: 496  Bit Score: 47.38  E-value: 1.41e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 139 SLYMAGVLIGAMvfgylADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:PRK03893  67 SRWFGGLLLGAM-----GDRYGRRLAMVISIVLFSVGTLACGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWPKHL 141
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 126723163 219 R--AYVGTLAGyvYSTGQFLLAGV-AYAVPH--WRYLQLLVSVP-FFAFF 262
Cdd:PRK03893 142 RnkASGFLISG--FSIGAVVAAQVySLVVPVwgWRALFFIGILPiIFALW 189
 
Name Accession Description Interval E-value
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
11-515 0e+00

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328  Cd Length: 505  Bit Score: 662.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   11 GGVGRFQRIQVTLVVLPLLLMASHNTLQNFTAAIPPHHCRPPAHANLSKDGGLQAWLPQDTQGRPKSCLRFTSPQERPPF 90
Cdd:TIGR00898   1 GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEHHCRLPDAANLSSRCELNLTLPRLPDGRPESCLRFMVDQWANPS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163   91 LNGTEANGTGT-----TEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLGQSLYMAGVLIGAMVFGYLADRLGRRKVL 165
Cdd:TIGR00898  81 LLGCEPLKLSDlglaaTEPCLDGWEYSYDTFSSTIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  166 ILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAYVGTLAGYVYSTGQFLLAGVAYAVP 245
Cdd:TIGR00898 161 LLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAYFIP 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  246 HWRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQKVARINGKqeegaKLSMEVLRTNLQKELTMSKGQAS 325
Cdd:TIGR00898 241 DWRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGK-----KLPAEVLSLSLEKDLSSSKKQYS 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  326 AMELLRCPALRHLFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLA 405
Cdd:TIGR00898 316 FLDLFRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGGNIYLDLFISGLVELPAKLITLLLIDRLGRRYTMAASLLLA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  406 GICILVNGVIPRDQSIVRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVSMTSELYPSL 485
Cdd:TIGR00898 396 GVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLVYLGEKWLFL 475
                         490       500       510
                  ....*....|....*....|....*....|
gi 126723163  486 PLFIYGAVPVAASAATALLPETLGQPLPDT 515
Cdd:TIGR00898 476 PLVLFGGLALLAGILTLFLPETKGVPLPET 505
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
135-505 7.59e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392  Cd Length: 352  Bit Score: 111.64  E-value: 7.59e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 135 QLGQSLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWM 214
Cdd:cd06174   37 GLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWF 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 215 PIHTRAYVGTLAGYVYSTGQFLLAGVAYAVPH---WRYLQLLVSVPFFAFFVYSWFFIesarwystpgrldltlkalqkv 291
Cdd:cd06174  117 PPKERGRALGLFSAGFGLGALLGPLLGGLLAEslgWRWLFLILAILGLLLALLLLFLL---------------------- 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 292 aringkqeegaklsmevlrtnlqkeltmskgqasamellrcpalrHLFLCLSLLWFATSFAYYGLVMDLQGFGVS----- 366
Cdd:cd06174  175 ---------------------------------------------RLLLLLALAFFLLSFGYYGLLTYLPLYLQEvlgls 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 367 ---IYLIQVIFGAVDLPAKLVCFLVINSLGRRP-AQMASLLLAGICILVNGVIPRDQSIVrtSLAVLGKGCLASSFNCIF 442
Cdd:cd06174  210 aaeAGLLLSLFGLGGILGALLGGLLSDRLGRRRlLLLIGLLLAALGLLLLALAPSLALLL--VALLLLGFGLGFAFPALL 287
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 126723163 443 LYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVS--MTSELYPSLPLFIYGAVPVAASAATALLP 505
Cdd:cd06174  288 TLASELAPPEARGTASGLFNTFGSLGGALGPLLAglLLDTGGYGGVFLILAALALLAALLLLLLP 352
Sugar_tr pfam00083
Sugar (and other) transporter;
139-512 1.80e-24

Sugar (and other) transporter;


Pssm-ID: 306568  Cd Length: 452  Bit Score: 106.20  E-value: 1.80e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSP---NFTVYCTFRLLSGMSLAGIALNCMTLNVEWMP 215
Cdd:pfam00083  53 SIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKgkwSVYQLIVGRVLVGIGVGGASVLAPMYISEIAP 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  216 IHTRAYVGTLAGYVYSTGQFLLAGVAYAVPH------WRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQ 289
Cdd:pfam00083 133 KKLRGALGSLYQLAITFGILLAYIFGLGLNKtsnsdgWRIPLGLQLVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLA 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  290 KvarINGkqEEGAKLSMEVLRTNLQKELTMSKgqASAMELLR-CPALRHLFLCLSLLWFA-----TSFAYYGLVMdLQGF 363
Cdd:pfam00083 213 K---LRG--VPDVDRELDEIKDSLEAGQEAEK--ASWKELFStKTRRQRLLIGVMLQIFQqltgiNAIFYYSTTI-FENL 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  364 GVSIYLIQ-VIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVNGVIPRDQ-------SIVRTSLAVLGKGCLA 435
Cdd:pfam00083 285 GLSDSFLVtIIVGVVNFVFTFIAIFLVDRFGRRPLLLLGAAGMAICFVILGIVALLGvsksdwaGIVAIVFIALFIAFFA 364
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  436 SSFNCI-FLYTGELYPTMIRQTGLGMGSTMARVGSIVsplvsmTSELYP----SLPLFIYGAVPVAASAATAL-----LP 505
Cdd:pfam00083 365 MGWGPVpWVIVSELFPLSVRSKAMALATAANWLANFL------IGFLFPiitdAIGLGYTFFIFAGLLVLFIIfvfffVP 438

                  ....*..
gi 126723163  506 ETLGQPL 512
Cdd:pfam00083 439 ETKGRTL 445
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
142-475 1.33e-21

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327  Cd Length: 398  Bit Score: 96.66  E-value: 1.33e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  142 MAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAY 221
Cdd:TIGR00895  62 LIGMAFGALFFGPLADRIGRRRVLLWSILLFSVFTLLCALATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRFRGT 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  222 VGTL--AGYV--YSTGQFlLAGVAYAVPHWRYLQL------LVSVPFFAFFVYswffiESARWYSTPGrldlTLKALQKV 291
Cdd:TIGR00895 142 AVGLmfCGYPigAAVGGF-LAGWLIPVFGWRSLFYvggiapLLLLLLLMRFLP-----ESIDFLVSKR----PETVRRIV 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  292 ARINGKQEEGAKLSMEVLRTNLQKEltmskgqASAMELLRCPALRHLFLCLSLLWFATSFAYYGL------VMDLQGFGV 365
Cdd:TIGR00895 212 NAIAPQMQAEAQSALPEQKSTQGTK-------RSVFKALFQGKTARITVLLWLLYFMLLVGVYFLtnwlpkLMVELGFSL 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  366 S---IYLIQVIFGAVdLPAKLVCFLvINSLGRRPAqMASLLLAGICILVNGVIPRDQSIVRTSLAVLGKgCLASSFNCIF 442
Cdd:TIGR00895 285 SlaaTGGALFNFGGV-IGSIIFGWL-ADRLGPRVT-ALLLLLGAVFAVLVGSTLFSPTLLLLLGAIAGF-FVNGGQSGLY 360
                         330       340       350
                  ....*....|....*....|....*....|...
gi 126723163  443 LYTGELYPTMIRQTGLGMGSTMARVGSIVSPLV 475
Cdd:TIGR00895 361 ALMALFYPTAIRATGVGWAIGIGRLGAIIGPIL 393
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
135-512 1.09e-19

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273317  Cd Length: 481  Bit Score: 92.02  E-value: 1.09e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  135 QLGQSLYMAGVLIGAMVFGYLADRLGRRKVLILN---YLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNV 211
Cdd:TIGR00879  74 GLVVSIFLVGGFIGALFAGWLSDRFGRKKSLLIIallFVIGAILMGLAAFALSVEMLIVGRVLLGIGVGIASALVPMYLS 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  212 EWMPIHTRAYVGTLAGYVYSTGQFLLAGVAYAV------PHWRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTL 285
Cdd:TIGR00879 154 EIAPKALRGALTSLYQLAITFGILVAYGFGSGKvslnntLGWRIPLGLQLIPAGLLFLGLFFLPESPRWLVGKGRVEEAR 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  286 KALQkvaRINGKQEEGAKLSMEVLRTNLQKELTMSKGQASAMELLRC--PALRHLFLCLSLLWFA-----TSFAYYGLVM 358
Cdd:TIGR00879 234 KSLA---RLRGTSGEDKELLDELELIDIKRSIEKRSVQPSWGSLFSStrRIRRRLFLGVVLQWFQqftgiNAIMYYSPTI 310
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  359 -------DLQGFGVSIyliqvIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVNGVIprDQSIVRTSLAVLGK 431
Cdd:TIGR00879 311 fenagvsTDHAFLVSI-----IVGAVNFAFTFVAIFLVDRFGRRPLLLIGAAGMAICLFVLGIL--GASFVTGSSKSSGN 383
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  432 GCLASSFNCIFLYT-----------GELYPTMIRQTGLGMGSTMARVGSIVSPLV--SMTSELYPSLPLFIYGAVPVAAS 498
Cdd:TIGR00879 384 VAIVFILLFIAFFAmgwgpvpwvivSEIFPLSLRPKGISIAVAANWLANFIVGFLfpTMLESIGVGGVFIFFGGLNVLGL 463
                         410
                  ....*....|....*
gi 126723163  499 AATA-LLPETLGQPL 512
Cdd:TIGR00879 464 IFVYfFLPETKGRTL 478
MFS_1 pfam07690
Major Facilitator Superfamily;
139-473 1.99e-16

Major Facilitator Superfamily;


Pssm-ID: 311564  Cd Length: 346  Bit Score: 80.55  E-value: 1.99e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:pfam07690  39 TLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLQGLGAGALFPAAAALIADWFPPEE 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  219 RAYVGTLAGYVYSTGQFL---LAGVAYAVPHWRYLQLLVSVPFFAFFVYSWFFiesarwystpgrldltLKALQKVARIN 295
Cdd:pfam07690 119 RGRALGLLSAGFGLGAALgplLGGLLASLFGWRAAFLILAILSLLAAVLAALL----------------LPRPPPESKRP 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  296 GKQEEGAKLSMEVLRtnlqkeltmskgqasameLLRCPALRHLFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFG 375
Cdd:pfam07690 183 KPAEEAPAPLLPAWK------------------LLLRDPVLWLLLALLLFGFAFFGLLTYLPLYQEVLGLSALLAGLLLG 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  376 AVDLPAKLVCFLV---INSLGRRPAQMASLLLAGICILVNGVIP--RDQSIVRTSLAVLGKGcLASSFNCIFLYTGELYP 450
Cdd:pfam07690 245 LAGLLGAIGRLLLgrlSDRLGRRRRLLLALLLAILAALGLLLLSltLSSLWLLLALLLLGFG-FGLVFPALNALVSDLAP 323
                         330       340
                  ....*....|....*....|...
gi 126723163  451 TMIRQTGLGMGSTMARVGSIVSP 473
Cdd:pfam07690 324 KEERGTASGLYNTAGSLGGALGP 346
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
123-356 9.22e-11

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366  Cd Length: 742  Bit Score: 64.23  E-value: 9.22e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  123 EWDLVCSHRALRQLGQSLYMaGVLIGAMVFGYLADRLGRRKVLILNylqTAVSGTCAAFSPNFTVYCTF---RLLSGMSL 199
Cdd:TIGR01299 194 EKDLCIPDSGKGMLGLIVYL-GMMVGAFFWGGLADKLGRKQCLLIC---LSVNGFFAFFSSFVQGYGFFlfcRLLSGFGI 269
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  200 AGIALNCMTLNVEWMPIHTRAYVGTLAGYVYSTGQFLLAGVAYA-VPH---------------WRYLQLLVSVPFFAFFV 263
Cdd:TIGR01299 270 GGAIPIVFSYFAEFLAQEKRGEHLSWLCMFWMIGGIYAAAMAWAiIPHygwsfqmgsayqfhsWRVFVIVCAFPCVFAIG 349
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  264 YSWFFIESARWYSTPGRLDLTLKALQKVARIN--GKQEEGAKLSMEVLRTNLQK-EL-----------------TMSKGQ 323
Cdd:TIGR01299 350 ALTFMPESPRFFLENGKHDEAWMILKLIHDTNmrAKGHPEKVFSVNHIKTIHQEdELieiesdtgtwyqrcfvrALSEGG 429
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 126723163  324 ASAMELLRC--PALRHLFLCLSLLWFATSFAYYGL 356
Cdd:TIGR01299 430 GIWGNFLRCfnPEVREITIKLMGVWFTLSFGYYGL 464
2A0112 TIGR00891
putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic ...
147-293 6.13e-10

putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273324  Cd Length: 405  Bit Score: 61.05  E-value: 6.13e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  147 IGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRAYVGTLA 226
Cdd:TIGR00891  62 FGALMFGLWGDRYGRRLPMVTSIVLFSAGTLACGFAPGYITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRNKASGLL 141
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 126723163  227 GYVYSTGqFLLAGVAYAV------PHWRYLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQKVAR 293
Cdd:TIGR00891 142 ISGYAVG-AVVAAQVYSLvvpvwgDGWRALFFISILPIIFALWLRKNIPEAEDWKEKHAGKALVRTMVDILYG 213
2A0106 TIGR00883
metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the ...
147-483 3.45e-08

metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273320  Cd Length: 394  Bit Score: 55.36  E-value: 3.45e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  147 IGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFT--------VYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:TIGR00883  50 LGAIVFGHFGDRIGRKKTLVITLLMMGIGTLLIGLLPSYAtigiwapiLLLLARLIQGFSLGGEWGGAALYLAEYAPPGK 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  219 RAYVGTLAGYVYSTGQFLLAGVAYAVPH-----------WRyLQLLVSVPFFAFFVYswffiesarwystpgrLDLTLKA 287
Cdd:TIGR00883 130 RGFYGSFQQVGAPVGLLLAALTVLLLSYllgddallewgWR-IPFLVSAVLVLIGLY----------------LRRNLEE 192
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  288 LQKVARINGKQEEGAKLSMEVLRTNlqkeltmskgqasamellrcpaLRHLFLCLsLLWFATSFAYYGLVMDLQGFGVS- 366
Cdd:TIGR00883 193 TPVFEKAQEKHKKKRGPIAETLTKH----------------------RKPFLLGL-GLVIATTTTFYLITTYLPTYLTQt 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  367 ----------IYLIQVIFGAVDLPaklVCFLVINSLGRRPaqmaSLLLAGICILVNGV-----IPRDQSIVRTSLAVLGK 431
Cdd:TIGR00883 250 lglsansallVLMLSLILFFITIP---LSGALSDRIGRRP----VLIIFTVLAALLAVpllmaLLDSGSFTLFFFLVLGM 322
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 126723163  432 GCLASSFNCIFLYT-GELYPTMIRQTGLGMGSTMARV---GS---IVSPLVSMTSELYP 483
Cdd:TIGR00883 323 ALIGGMYTGPMGSFlPELFPTEVRYTGASLAYNLAGAifgGFapyIAAALVAMTGDWYA 381
2A0109 TIGR00887
phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the ...
143-514 3.62e-08

phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]


Pssm-ID: 129965  Cd Length: 502  Bit Score: 55.89  E-value: 3.62e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  143 AGVLIGAMVFGYLADRLGRRKV----LILNYLQTAVSGTCAAFSPNFTVY--CTFRLLSGMSLAGIALNCMTLNVEWMPI 216
Cdd:TIGR00887  67 IGTLAGQLFFGWLADKLGRKRVygmeLIIMIIATVASGLSPGSSPKSVMAtlCFWRFWLGVGIGGDYPLSAIITSEFATK 146
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  217 HTRayvGTLAGYVYST---GQ--------FLLAG--------------VAYAVPH----WRYLQLLVSVPFFAFFVYSWF 267
Cdd:TIGR00887 147 KWR---GAMMAAVFAMqgfGIlagaivalIVLAGfkhsleaaadeascTGSCVPAvdymWRILIGFGAVPALLALYFRLT 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  268 FIESARWYSTPGRlDLTLKALQKVARINGKQE------EGAKLSMEVLRTNlQKELTMSKGQASAMELLrcpalrhlfLC 341
Cdd:TIGR00887 224 IPETPRYTADVAK-DVEQAASDMSAVLQVKIEaepdevEKASTAVEVPKAS-WSDFFTHFFKWRHGKHL---------LG 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  342 LSLLWFATSFAYYGLVMD----LQGFGVS-----------IY------LIQVIFGAVdlPAKLVCFLVINSLGRRPAQMA 400
Cdd:TIGR00887 293 TAGSWFLLDIAFYGVNLNqkviLSAIGYSppaatnnayeeLYktavgnLIIALAGTV--PGYWVTVFLVDIIGRKPIQLM 370
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  401 SLLLAGICILVNGvIPRDQSIVRTSLAVLGKGCLASSFN---CIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPL--- 474
Cdd:TIGR00887 371 GFFILTVLFFVLG-FAYNHLSTHGFLAIYVLAQFFANFGpnaTTFIVPGEVFPTRYRSTAHGISAASGKAGAIIGQFgfl 449
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*....
gi 126723163  475 ----VSMTSELYPSLP-----LFIYGAVPVAASAATALLPETLGQPLPD 514
Cdd:TIGR00887 450 ylaqHGDPTKGYPTGIwmghvLEIFALFMFLGILFTLLIPETKGKSLEE 498
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
139-202 1.17e-07

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371  Cd Length: 394  Bit Score: 53.77  E-value: 1.17e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 126723163 139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGI 202
Cdd:COG2814   55 TAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAPSFAVLLLARALAGLAHGVF 118
2_A_01_02 TIGR00880
Multidrug resistance protein;
139-270 1.78e-06

Multidrug resistance protein;


Pssm-ID: 273318  Cd Length: 141  Bit Score: 47.64  E-value: 1.78e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:TIGR00880   5 AGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFLQGFGAAFALVAGAALIADIYPPEE 84
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 126723163  219 RAYVGTLAGYVYSTGQFL---LAGVAYAVPHWRYLQLLVSVPFFAFFVYSWFFIE 270
Cdd:TIGR00880  85 RGVALGLMSAGIALGPLLgppLGGVLAQFLGWRAPFLFLAILALAAFILLAFLLP 139
PRK03893 PRK03893
putative sialic acid transporter; Provisional
139-262 1.41e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668  Cd Length: 496  Bit Score: 47.38  E-value: 1.41e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 139 SLYMAGVLIGAMvfgylADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:PRK03893  67 SRWFGGLLLGAM-----GDRYGRRLAMVISIVLFSVGTLACGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWPKHL 141
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 126723163 219 R--AYVGTLAGyvYSTGQFLLAGV-AYAVPH--WRYLQLLVSVP-FFAFF 262
Cdd:PRK03893 142 RnkASGFLISG--FSIGAVVAAQVySLVVPVwgWRALFFIGILPiIFALW 189
xylE PRK10077
D-xylose transporter XylE; Provisional
144-514 6.57e-05

D-xylose transporter XylE; Provisional


Pssm-ID: 182225  Cd Length: 479  Bit Score: 45.45  E-value: 6.57e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 144 GVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAF---------SPNFTVYCTF---RLLSGMSLAGIALNCMTLNV 211
Cdd:PRK10077  67 GCIIGGALGGYCSNRFGRRDSLKIAAVLFFISALGSAWpefgftsigPDNTGYVPEFviyRIIGGIGVGLASMLSPMYIA 146
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 212 EWMPIHTRayvGTLAgyvySTGQF-LLAG--VAYAVPH---------------WRYLQLLVSVP--FFAFFVYswFFIES 271
Cdd:PRK10077 147 EIAPAHIR---GKLV----SFNQFaIIFGqlVVYFVNYfiarsgdaswlntdgWRYMFASEAIPalLFLMLLY--FVPET 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 272 ARWYSTPGRLDltlKALQKVARINGKQEegAKLSMEVLRTnlqkelTMSKGQASAMELLRCPALRhLFLCLSLLWFATSF 351
Cdd:PRK10077 218 PRYLMSRGKQE---QAEGILRKIMGNTL--ATQALQEIKH------SLDHGRKTGGKLLMFGVGV-IVIGVMLSVFQQFV 285
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 352 A-----YYG-LVMDLQGFGVSIYLIQ-VIFGAVDLPAKLVCFLVINSLGRRPAQMASLLlaGICILVNGVIPRDQSIVRT 424
Cdd:PRK10077 286 GinvvlYYApEIFKTLGASTDIALLQtIIVGVINLTFTVLAIMTVDKFGRKPLQIIGAL--GMAIGMFSLGTAFYTQAPG 363
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 425 SLAVLGKGCLASSFN------CIFLYTgELYPTMIRQTGLGMGSTMARVGS-IVS---PLVSMTSELY----PSLPLFIY 490
Cdd:PRK10077 364 IVALLSMLFYVAAFAmswgpvCWVLLS-EIFPNAIRGKALAIAVAAQWIANyFVSwtfPMMDKNSWLVahfhNGFSYWIY 442
                        410       420
                 ....*....|....*....|....*
gi 126723163 491 GAVPV-AASAATALLPETLGQPLPD 514
Cdd:PRK10077 443 GCMGVlAALFMWKFVPETKGKTLEE 467
ProP COG0477
MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and ...
139-415 2.03e-04

MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and metabolism, Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 223553  Cd Length: 338  Bit Score: 43.53  E-value: 2.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVY--CTFRLLSGMSLAGIALNCMTLNVEWMPI 216
Cdd:COG0477   46 SAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGTLLLALAPNVGLAllLILRLLQGLGGGGLLPVASALLSEWFPE 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 217 HTRAyvGTLAGYVYSTGQFLLAGVAYAVPHWryLQLLVSVPFFAFFVYSWFFIESARWYSTPGRLDLTLKALQKVARING 296
Cdd:COG0477  126 ATER--GLAVGLVTLGAGALGLALGPLLAGL--LLGALLWGWRAAFLLAALLGLLLLILVLLLDLLLAAPRLPLAVGLAL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 297 KQEEGAKLSMEVLRTNLQKELTMSKGQASAMELLRCPALRHLFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGA 376
Cdd:COG0477  202 IELGKLLLLLLILLLGGLVLLLLGLYLSAAGFGLRALLLGLGLALLALFVGALILLVLLPILLGAAGGLSALVGAAGGLL 281
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 126723163 377 VDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVNGVI 415
Cdd:COG0477  282 ALILLGLAGLLGTLVGGSLLVDRLGRSLGLRAILLAGAL 320
efflux_Bcr_CflA TIGR00710
drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a ...
135-196 3.40e-04

drug resistance transporter, Bcr/CflA subfamily; This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 12 membrane-spanning regions. Members with known activity include Bcr (bicyclomycin resistance protein) in E. coli, Flor (chloramphenicol and florfenicol resistance) in Salmonella typhimurium DT104, and CmlA (chloramphenicol resistance) in Pseudomonas sp. plasmid R1033.


Pssm-ID: 273229  Cd Length: 385  Bit Score: 42.76  E-value: 3.40e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 126723163  135 QLGQSLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSG 196
Cdd:TIGR00710  43 QMTLTLYLLGFAAGQLLWGPLSDRYGRRPVLLLGLFIFALSSLGLALSNNIETLLVLRFVQA 104
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
338-505 4.46e-04

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392  Cd Length: 352  Bit Score: 42.30  E-value: 4.46e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 338 LFLCLSLLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVCFLVINSLGRRPAQMASLLLAGICILVNGVIPR 417
Cdd:cd06174    7 GFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLLLAFASS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 418 DQSIVrTSLAVLGKGClASSFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVS--MTSELYPSLPLFIYGAVPV 495
Cdd:cd06174   87 LWLLL-VGRFLLGLGG-GALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGglLAESLGWRWLFLILAILGL 164
                        170
                 ....*....|
gi 126723163 496 AASAATALLP 505
Cdd:cd06174  165 LLALLLLFLL 174
PRK15403 PRK15403
multidrug efflux system protein MdtM; Provisional
139-203 1.17e-03

multidrug efflux system protein MdtM; Provisional


Pssm-ID: 237958  Cd Length: 413  Bit Score: 41.35  E-value: 1.17e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 126723163 139 SLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIA 203
Cdd:PRK15403  58 SLYLAGGMALQWLLGPLSDRIGRRPVLITGALIFTLACAATLFTTSMTQFLIARFIQGTSICFIA 122
2A0106 TIGR00883
metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the ...
142-247 1.56e-03

metabolite-proton symporter; This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273320  Cd Length: 394  Bit Score: 40.72  E-value: 1.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  142 MAGVLIGAMVF----GYLADRLGRRKVLILNYLQTAVSGTCAAF----SPNFTVYctFRLLSGMSLAGIALNCM--TLNV 211
Cdd:TIGR00883 261 LMLSLILFFITiplsGALSDRIGRRPVLIIFTVLAALLAVPLLMalldSGSFTLF--FFLVLGMALIGGMYTGPmgSFLP 338
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 126723163  212 EWMPIHTRaYVGtlAGYVYSTGQFLLAGVAYAVPHW 247
Cdd:TIGR00883 339 ELFPTEVR-YTG--ASLAYNLAGAIFGGFAPYIAAA 371
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
144-231 2.29e-03

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927  Cd Length: 406  Bit Score: 40.33  E-value: 2.29e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 144 GVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMPIHTRayvG 223
Cdd:PRK11551  62 GLLPGALLGGRLADRIGRKRILIVSVALFGLFSLATAQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLR---G 138

                 ....*...
gi 126723163 224 TLAGYVYS 231
Cdd:PRK11551 139 TAVSLMYC 146
PRK09952 PRK09952
shikimate transporter; Provisional
147-233 3.03e-03

shikimate transporter; Provisional


Pssm-ID: 182163  Cd Length: 438  Bit Score: 40.10  E-value: 3.03e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163 147 IGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFT--------VYCTFRLLSGMSLAGIALNCMTLNVEWMPIHT 218
Cdd:PRK09952  79 LGGVVFGHFGDRLGRKRMLMLTVWMMGIATALIGLLPSFStigwwapvLLVTLRAIQGFAVGGEWGGAALLAVESAPKNK 158
                         90       100
                 ....*....|....*....|.
gi 126723163 219 RAY------VGTLAGYVYSTG 233
Cdd:PRK09952 159 KAFyssgvqVGYGVGLLLSTG 179
HpaX TIGR02332
4-hydroxyphenylacetate permease; This protein is a part of the Major Facilitator Superfamily ...
136-302 8.32e-03

4-hydroxyphenylacetate permease; This protein is a part of the Major Facilitator Superfamily (pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. ( as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.


Pssm-ID: 131385  Cd Length: 412  Bit Score: 38.43  E-value: 8.32e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  136 LGQSLYMAGVLIGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRLLSGMSLAGIALNCMTLNVEWMP 215
Cdd:TIGR02332  47 LAATLFYAAYVICGIPSNIMLAIIGARRWIAGIMVLWGIASTATMFATGPESLYLLRILVGIAEAGFLPGILLYLTFWFP 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126723163  216 IHTRAY----------VGTLAGYVYSTGQFLLAGVaYAVPHWRYLQLLVSVPFFAFFVYSWFFI----ESARWYSTPGRl 281
Cdd:TIGR02332 127 AYFRARanalfmiampVTMALGLILSGYILALDGL-MALKGWQWLFLLEGFPSVILGVMTWFWLddspDKAKWLDEEDK- 204
                         170       180
                  ....*....|....*....|.
gi 126723163  282 dLTLKALQKVARINGKQEEGA 302
Cdd:TIGR02332 205 -KALKEMIDNDQLTLEQPEGA 224
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH