NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|122937341|ref|NP_001073943|]
View 

uncharacterized protein C2orf78 [Homo sapiens]

Protein Classification

DUF4629 and Atrophin-1 domain-containing protein (domain architecture ID 12173483)

DUF4629 and Atrophin-1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF4629 pfam15442
Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is ...
495-643 2.06e-82

Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is approximately 150 amino acids in length. There are two conserved sequence motifs: MHML and LGKK.


:

Pssm-ID: 317796  Cd Length: 150  Bit Score: 264.99  E-value: 2.06e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  495 HSDQVRKNKHKASEPIQGAPKAKIQPKNPECLLEREVVVGSATVSNSASVNKAKHSSNKPHKAASSRISKTKSHGQEKTK 574
Cdd:pfam15442   1 PSDQVRKNKHKASEPIDGAPQAKIQPKDPECLLGGEVVICSAAASDRAPVNMAKHSNSKAQKAASSRTSKTKGHGQEKTK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 122937341  575 GNRKNSSKKSEESKQSGKKVKVEEKQTIPNMKRKKNQPELSQKTLKKPRSSLGMHMLESVQVFHALGKK 643
Cdd:pfam15442  81 RTRENNSKKAEERKQSGNKVKAEEKPTIPKTKRKRNQPELSQESFKKPRSCLGMHMLESVQVFHPLGKK 149
Atrophin-1 super family cl26464
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
711-881 1.09e-06

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


The actual alignment was detected with superfamily member PHA03247:

Pssm-ID: 331285  Cd Length: 3151  Bit Score: 52.63  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  711 PPPGKVKLIPLPFLTLDQPQArhVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPTNTS-LTGPATPAQPISA 789
Cdd:PHA03247 2742 PAVPAGPATPGGPARPARPPT--TAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPAdPPAAVLAPAAALP 2819
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  790 KATQPSSANPTQPTVPQSAASRPSAYKTSS---CSSL-----------QREPVSTAVTS----LRSLPKPQNQFLIQDFS 851
Cdd:PHA03247 2820 PAASPAGPLPPPTSAQPTAPPPPPGPPPPSlplGGSVapggdvrrrppSRSPAAKPAAParppVRRLARPAVSRSTESFA 2899
                         170       180       190
                  ....*....|....*....|....*....|...
gi 122937341  852 L---QPRPWRKPTVPEPVMSTPitEEQRPEREA 881
Cdd:PHA03247 2900 LppdQPERPPQPQAPPPPQPQP--QPPPPPQPQ 2930
 
Name Accession Description Interval E-value
DUF4629 pfam15442
Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is ...
495-643 2.06e-82

Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is approximately 150 amino acids in length. There are two conserved sequence motifs: MHML and LGKK.


Pssm-ID: 317796  Cd Length: 150  Bit Score: 264.99  E-value: 2.06e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  495 HSDQVRKNKHKASEPIQGAPKAKIQPKNPECLLEREVVVGSATVSNSASVNKAKHSSNKPHKAASSRISKTKSHGQEKTK 574
Cdd:pfam15442   1 PSDQVRKNKHKASEPIDGAPQAKIQPKDPECLLGGEVVICSAAASDRAPVNMAKHSNSKAQKAASSRTSKTKGHGQEKTK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 122937341  575 GNRKNSSKKSEESKQSGKKVKVEEKQTIPNMKRKKNQPELSQKTLKKPRSSLGMHMLESVQVFHALGKK 643
Cdd:pfam15442  81 RTRENNSKKAEERKQSGNKVKAEEKPTIPKTKRKRNQPELSQESFKKPRSCLGMHMLESVQVFHPLGKK 149
PHA03247 PHA03247
large tegument protein UL36; Provisional
711-881 1.09e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 52.63  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  711 PPPGKVKLIPLPFLTLDQPQArhVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPTNTS-LTGPATPAQPISA 789
Cdd:PHA03247 2742 PAVPAGPATPGGPARPARPPT--TAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPAdPPAAVLAPAAALP 2819
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  790 KATQPSSANPTQPTVPQSAASRPSAYKTSS---CSSL-----------QREPVSTAVTS----LRSLPKPQNQFLIQDFS 851
Cdd:PHA03247 2820 PAASPAGPLPPPTSAQPTAPPPPPGPPPPSlplGGSVapggdvrrrppSRSPAAKPAAParppVRRLARPAVSRSTESFA 2899
                         170       180       190
                  ....*....|....*....|....*....|...
gi 122937341  852 L---QPRPWRKPTVPEPVMSTPitEEQRPEREA 881
Cdd:PHA03247 2900 LppdQPERPPQPQAPPPPQPQP--QPPPPPQPQ 2930
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
704-878 2.58e-03

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904  Cd Length: 886  Bit Score: 41.44  E-value: 2.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  704 SPSHSELPPPGKVKLIPLPFLTLDQPQARHVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPT---NTSLTGP 780
Cdd:pfam05109 424 APESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSprdNGTESKA 503
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  781 ATPAQPISAKAT-QPSSANPTQP-TVPQSAASRPSAYKTSSCSSLQrEPVSTAVTSLRSLPKPQNQFLIQDFSlQPRPWR 858
Cdd:pfam05109 504 PDMTSPTSAVTTpTPNATSPTPAvTTPTPNATSPTLGKTSPTSAVT-TPTPNATSPTPAVTTPTPNATIPTLG-KTSPTS 581
                         170       180
                  ....*....|....*....|
gi 122937341  859 KPTVPEPVMSTPITEEQRPE 878
Cdd:pfam05109 582 AVTTPTPNATSPTVGETSPQ 601
COG5373 COG5373
Uncharacterized membrane protein [Function unknown];
718-814 4.49e-03

Uncharacterized membrane protein [Function unknown];


Pssm-ID: 227665  Cd Length: 931  Bit Score: 40.58  E-value: 4.49e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 718 LIPLPFLTLDQPQArhvSRRPNPLAsrrpAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGPATPAQPISAKATQPSSA 797
Cdd:COG5373   38 LVAEGAAGPVAKAA---EQMAAPEA----AEAAPLPAAAESIASPEVPPPVPPAPAQEGEAPAAEQPSAVPAPSAAPAPA 110
                         90
                 ....*....|....*..
gi 122937341 798 NPTQPtvpqSAASRPSA 814
Cdd:COG5373  111 EPVEP----SLAANPFA 123
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
497-718 8.66e-03

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271  Cd Length: 1388  Bit Score: 39.64  E-value: 8.66e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  497 DQVRKNKHKASEPIQGApKAKIQPKNPECLLEREVVVGSATVSNSASVNKAK---HSSNKPHKAASSRISKTKSHGQEKT 573
Cdd:PTZ00108 1148 EEKEIAKEQRLKSKTKG-KASKLRKPKLKKKEKKKKKSSADKSKKASVVGNSkrvDSDEKRKLDDKPDNKKSNSSGSDQE 1226
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  574 KGNRKNSSKKSEESKQSGKKVKVEEKQTIPNMKRKKNQPELSQKTLKKPrsslgmhmlESVQVFHALGKKIdMKTGFSSS 653
Cdd:PTZ00108 1227 DDEEQKTKPKKSSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGKPKNAP---------KRVSAVQYSPPPP-SKRPDGES 1296
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 122937341  654 RTLGSSSNTQNRQPFPALKPWLDIQHEGKGPEKIQVKAQKLDGSAEKECTSPSHSELPPPGKVKL 718
Cdd:PTZ00108 1297 NGGSKPSSPTKKKVKKRLEGSLAALKKKKKSEKKTARKKKSKTRVKQASASQSSRLLRRPRKKKS 1361
 
Name Accession Description Interval E-value
DUF4629 pfam15442
Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is ...
495-643 2.06e-82

Domain of unknown function (DUF4629); This domain family is found in eukaryotes, and is approximately 150 amino acids in length. There are two conserved sequence motifs: MHML and LGKK.


Pssm-ID: 317796  Cd Length: 150  Bit Score: 264.99  E-value: 2.06e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  495 HSDQVRKNKHKASEPIQGAPKAKIQPKNPECLLEREVVVGSATVSNSASVNKAKHSSNKPHKAASSRISKTKSHGQEKTK 574
Cdd:pfam15442   1 PSDQVRKNKHKASEPIDGAPQAKIQPKDPECLLGGEVVICSAAASDRAPVNMAKHSNSKAQKAASSRTSKTKGHGQEKTK 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 122937341  575 GNRKNSSKKSEESKQSGKKVKVEEKQTIPNMKRKKNQPELSQKTLKKPRSSLGMHMLESVQVFHALGKK 643
Cdd:pfam15442  81 RTRENNSKKAEERKQSGNKVKAEEKPTIPKTKRKRNQPELSQESFKKPRSCLGMHMLESVQVFHPLGKK 149
PHA03247 PHA03247
large tegument protein UL36; Provisional
711-881 1.09e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 52.63  E-value: 1.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  711 PPPGKVKLIPLPFLTLDQPQArhVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPTNTS-LTGPATPAQPISA 789
Cdd:PHA03247 2742 PAVPAGPATPGGPARPARPPT--TAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPAdPPAAVLAPAAALP 2819
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  790 KATQPSSANPTQPTVPQSAASRPSAYKTSS---CSSL-----------QREPVSTAVTS----LRSLPKPQNQFLIQDFS 851
Cdd:PHA03247 2820 PAASPAGPLPPPTSAQPTAPPPPPGPPPPSlplGGSVapggdvrrrppSRSPAAKPAAParppVRRLARPAVSRSTESFA 2899
                         170       180       190
                  ....*....|....*....|....*....|...
gi 122937341  852 L---QPRPWRKPTVPEPVMSTPitEEQRPEREA 881
Cdd:PHA03247 2900 LppdQPERPPQPQAPPPPQPQP--QPPPPPQPQ 2930
PHA03247 PHA03247
large tegument protein UL36; Provisional
697-870 7.14e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 49.94  E-value: 7.14e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  697 SAEKECTSPSHSELPPPGKVKLIPL-------PFLTLDQPQAR--HVSRRP-------NPLASRRPAVAYPARPDSTNSA 760
Cdd:PHA03247 2816 AALPPAASPAGPLPPPTSAQPTAPPpppgpppPSLPLGGSVAPggDVRRRPpsrspaaKPAAPARPPVRRLARPAVSRST 2895
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  761 QSNAVNPSRPAPTNTsltgPATPAQPISaKATQPSSANPTQPTVPQSAASRPSAYKTSSCSSLQREPVstavtslrsLPK 840
Cdd:PHA03247 2896 ESFALPPDQPERPPQ----PQAPPPPQP-QPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGA---------VPQ 2961
                         170       180       190
                  ....*....|....*....|....*....|...
gi 122937341  841 PQNQFLIQDFSLQPR---PWRKPTVPEPVMSTP 870
Cdd:PHA03247 2962 PWLGALVPGRVAVPRfrvPQPAPSREAPASSTP 2994
PHA03247 PHA03247
large tegument protein UL36; Provisional
662-877 8.96e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 49.55  E-value: 8.96e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  662 TQNRQPFPALKPWLDIQHEGKGPEKIQVKAQKLDGSAEKECTSPSHSELPPPGKVKLIPLPFLTLDQPQARHVSRRPNPL 741
Cdd:PHA03247 2636 NEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHAL 2715
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  742 ASRRPAVAYPARPDSTNSAQSNAvnPSRPAPTNTSLT--GPATPAQPiSAKATQPSSANPTQP-TVPQSAASRPsaykts 818
Cdd:PHA03247 2716 VSATPLPPGPAAARQASPALPAA--PAPPAVPAGPATpgGPARPARP-PTTAGPPAPAPPAAPaAGPPRRLTRP------ 2786
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 122937341  819 scsslqrePVSTAVTSLRSLPKPqnqfliQDFSLQPRPWRKPTVPEPVMSTPITEEQRP 877
Cdd:PHA03247 2787 --------AVASLSESRESLPSP------WDPADPPAAVLAPAAALPPAASPAGPLPPP 2831
PHA03247 PHA03247
large tegument protein UL36; Provisional
705-894 2.51e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 48.40  E-value: 2.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  705 PSHSELPPPGKVKLIPLPFltldQPQARHVSRRPNPLASRRPAVAY-PARPDSTNSAQSNAV--NPSRPAPTNTSLTGP- 780
Cdd:PHA03247 2705 PPTPEPAPHALVSATPLPP----GPAAARQASPALPAAPAPPAVPAgPATPGGPARPARPPTtaGPPAPAPPAAPAAGPp 2780
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  781 --ATPAQPISAKATQPSSANPTQPTVPQSAASRPSAYKTSSCSSLQREPVSTAV--TSLRSLPKPQNQFLIQDFSLQP-R 855
Cdd:PHA03247 2781 rrLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAqpTAPPPPPGPPPPSLPLGGSVAPgG 2860
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 122937341  856 PWRKPTVPEPVMSTPITEEQRPEREAMKRKAQQERENAA 894
Cdd:PHA03247 2861 DVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFA 2899
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
716-898 2.65e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874  Cd Length: 614  Bit Score: 44.38  E-value: 2.65e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 716 VKLIPLPFLTLDQPQARHVSRRPNPLASRrPAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGPATPAQPISAKATQPS 795
Cdd:PRK14971 357 IQLAQLTQKGDDASGGRGPKQHIKPVFTQ-PAAAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPAGTPPTVSVDPPAAV 435
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 796 SANPTQpTVPQSAasrpsayKTSSCSSLQREPVSTAVTSLRSLPKPQNQfliqdfslqprPWRKPTVPEPVMSTPITEE- 874
Cdd:PRK14971 436 PVNPPS-TAPQAV-------RPAQFKEEKKIPVSKVSSLGPSTLRPIQE-----------KAEQATGNIKEAPTGTQKEi 496
                        170       180       190
                 ....*....|....*....|....*....|
gi 122937341 875 ------QRPEREAMKRKAQQERENAAKYTS 898
Cdd:PRK14971 497 fteedlQYYWQEFAGTRPQEEKALKETMIN 526
PHA03247 PHA03247
large tegument protein UL36; Provisional
705-877 4.47e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 44.16  E-value: 4.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  705 PSHSELPPPGKvkliPLPFLTLDQPQARHVSRR------------------PNPLAsrrPAVAYPARPDSTNSAQSNAVN 766
Cdd:PHA03247 2504 PDPDAPPAPSR----LAPAILPDEPVGEPVHPRmltwirgleelasddagdPPPPL---PPAAPPAAPDRSVPPPRPAPR 2576
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  767 PSRPAPTNTSlTGPATPAQPISAKA-----------TQPSSANPTQ------PTVPQSAASRPSAYKTSSCSSLQREPVS 829
Cdd:PHA03247 2577 PSEPAVTSRA-RRPDAPPQSARPRApvddrgdprgpAPPSPLPPDThapdppPPSPSPAANEPDPHPPPTVPPPERPRDD 2655
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 122937341  830 TAVTSLRSLPKPQNQFLIQDFSLQPRPWRKPTVPEPVmsTPITEEQRP 877
Cdd:PHA03247 2656 PAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTV--GSLTSLADP 2701
PRK10263 PRK10263
DNA translocase FtsK; Provisional
746-877 8.72e-04

DNA translocase FtsK; Provisional


Pssm-ID: 236669  Cd Length: 1355  Bit Score: 43.15  E-value: 8.72e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  746 PAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGPATPA-------QPISAKATQPSSANPTQPTVPQSAASRPSAYKTS 818
Cdd:PRK10263  747 PIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQQPQQPVapqpqyqQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAP 826
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 122937341  819 SCSSLQREPvstavtslRSLPKPQNQfLIQDFSLQ---PRPWRKPTVPEPVMS--TPITEEQRP 877
Cdd:PRK10263  827 QPQYQQPQQ--------PVAPQPQDT-LLHPLLMRngdSRPLHKPTTPLPSLDllTPPPSEVEP 881
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
738-842 9.08e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906  Cd Length: 830  Bit Score: 42.91  E-value: 9.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 738 PNPLASRRPAVAYPARPDSTNSAQSNAVNPS-----RPAPTNTSLTGPATPAQPISAKATQPSSANPTQPTVPQSAASrP 812
Cdd:PRK07003 417 AAAATRAEAPPAAPAPPATADRGDDAADGDApvpakANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAP-R 495
                         90       100       110
                 ....*....|....*....|....*....|
gi 122937341 813 SAYKTSSCSSLQREPVSTAVTSLRSLPKPQ 842
Cdd:PRK07003 496 AAAPSAATPAAVPDARAPAAASREDAPAAA 525
PTZ00395 PTZ00395
Sec24-related protein; Provisional
754-898 2.01e-03

Sec24-related protein; Provisional


Pssm-ID: 185594  Cd Length: 1560  Bit Score: 41.98  E-value: 2.01e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  754 PDSTNSAQSNAVNP----SRPAPTNTSLTGPATPAQPIS-AKATQPSSANPTQPTVPQSAAS-RPSAYKTSSCSSLQREP 827
Cdd:PTZ00395  417 PGNSNPGYNNAPNSntpyNNPPNSNTPYSNPPNSNPPYSnLPYSNTPYSNAPLSNAPPSSAKdHHSAYHAAYQHRAANQP 496
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  828 VSTAVTSLRSLPKP---------QNQFLIQDFSLQPRPWRKPTVPEPVMSTpiTEEQRPEREAMKRKAQQERENAAKYTS 898
Cdd:PTZ00395  497 AANLPTANQPAANNfhgaagnsvGNPFASRPFGSAPYGGNAATTADPNGIA--KREDHPEGGTNRQKYEQSDEESVESSS 574
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
704-878 2.58e-03

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.


Pssm-ID: 282904  Cd Length: 886  Bit Score: 41.44  E-value: 2.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  704 SPSHSELPPPGKVKLIPLPFLTLDQPQARHVSRRPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPT---NTSLTGP 780
Cdd:pfam05109 424 APESTTTSPTLNTTGFAAPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSprdNGTESKA 503
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  781 ATPAQPISAKAT-QPSSANPTQP-TVPQSAASRPSAYKTSSCSSLQrEPVSTAVTSLRSLPKPQNQFLIQDFSlQPRPWR 858
Cdd:pfam05109 504 PDMTSPTSAVTTpTPNATSPTPAvTTPTPNATSPTLGKTSPTSAVT-TPTPNATSPTPAVTTPTPNATIPTLG-KTSPTS 581
                         170       180
                  ....*....|....*....|
gi 122937341  859 KPTVPEPVMSTPITEEQRPE 878
Cdd:pfam05109 582 AVTTPTPNATSPTVGETSPQ 601
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
682-895 3.66e-03

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748  Cd Length: 576  Bit Score: 40.68  E-value: 3.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 682 KGPEKIQVKaqkldgSAEKECTSPSHSELPPPGK-VKLIPLpfltldQPQARHVSRRPNPLASRRPAVAYPARPDSTNSA 760
Cdd:PLN03209 337 DGPKPVPTK------PVTPEAPSPPIEEEPPQPKaVVPRPL------SPYTAYEDLKPPTSPIPTPPSSSPASSKSVDAV 404
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 761 QSNAVNPSRPAPTNTSlTGPATPAQPISAKATQPSS--------ANPTQPTVPQSAASRPSAYKTSSCSSLQREPVSTAV 832
Cdd:PLN03209 405 AKPAEPDVVPSPGSAS-NVPEVEPAQVEAKKTRPLSpyaryedlKPPTSPSPTAPTGVSPSVSSTSSVPAVPDTAPATAA 483
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 122937341 833 TSLR----SLPKPQNQFLIQDfSLQPRPWRKPTVPEPVMSTPITEEQRPEREAMKRKAQQERENAAK 895
Cdd:PLN03209 484 TDAAapppANMRPLSPYAVYD-DLKPPTSPSPAAPVGKVAPSSTNEVVKVGNSAPPTALADEQHHAQ 549
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
711-900 3.69e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057  Cd Length: 700  Bit Score: 41.01  E-value: 3.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 711 PPPGKVKLIPLPFLTLDQPQARHVSR-RPNPLASRRPAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGPATPAQPISA 789
Cdd:PRK12323 374 PATAAAAPVAQPAPAAAAPAAAAPAPaAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPA 453
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 790 KATQPSSANPTQPTVPQSAASRPSAYKTSSCSSLQREPVSTAVTSLRSLPKPQNQFLIQDFSLQPRPWRKPTVPEPVMST 869
Cdd:PRK12323 454 PAAAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPATAD 533
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 122937341 870 PITE-----EQRPEREAMKRKAQQERENAAKYTSLG 900
Cdd:PRK12323 534 PDDAfetlaPAPAAAPAPRAAAATEPVVAPRPPRAS 569
PHA02682 PHA02682
ORF080 virion core protein; Provisional
709-879 3.73e-03

ORF080 virion core protein; Provisional


Pssm-ID: 177464  Cd Length: 280  Bit Score: 40.23  E-value: 3.73e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 709 ELPPPGKVKLIPLPFLTLDQPQARHVSR-RPNPLASRRPAVAYPARPdstnsaqsnavNPSRPAP-TNTSLTGPATPAQP 786
Cdd:PHA02682  38 AAPCPPDADVDPLDKYSVKEAGRYYQSRlKANSACMQRPSGQSPLAP-----------SPACAAPaPACPACAPAAPAPA 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 787 ISAKATQPSSANPTQPTVPQSAASRPSAYKTSSCSSLQRE-PVSTAVTSLRSLPKPQNQFLIQDFSLQPRPWRK-PTVPE 864
Cdd:PHA02682 107 VTCPAPAPACPPATAPTCPPPAVCPAPARPAPACPPSTRQcPPAPPLPTPKPAPAAKPIFLHNQLPPPDYPAAScPTIET 186
                        170
                 ....*....|....*
gi 122937341 865 PVMSTPITEEQRPER 879
Cdd:PHA02682 187 APAASPVLEPRIPDK 201
COG5373 COG5373
Uncharacterized membrane protein [Function unknown];
718-814 4.49e-03

Uncharacterized membrane protein [Function unknown];


Pssm-ID: 227665  Cd Length: 931  Bit Score: 40.58  E-value: 4.49e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 718 LIPLPFLTLDQPQArhvSRRPNPLAsrrpAVAYPARPDSTNSAQSNAVNPSRPAPTNTSLTGPATPAQPISAKATQPSSA 797
Cdd:COG5373   38 LVAEGAAGPVAKAA---EQMAAPEA----AEAAPLPAAAESIASPEVPPPVPPAPAQEGEAPAAEQPSAVPAPSAAPAPA 110
                         90
                 ....*....|....*..
gi 122937341 798 NPTQPtvpqSAASRPSA 814
Cdd:COG5373  111 EPVEP----SLAANPFA 123
PHA03379 PHA03379
EBNA-3A; Provisional
711-863 4.85e-03

EBNA-3A; Provisional


Pssm-ID: 223066  Cd Length: 935  Bit Score: 40.43  E-value: 4.85e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 711 PPPGKVKLIPLPFLtldqpqARHVSRRPNPLASRRPAVAY-PARPDSTNSA-----QSNAVNPSRPAPTNTSLTGPATPA 784
Cdd:PHA03379 488 VQDGRPACAPVPAP------AGPIVRPWEASLSQVPGVAFaPVMPQPMPVEpvpvpTVALERPVCPAPPLIAMQGPGETS 561
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341 785 QPISAK---ATQPSSANPTQPTVPQS-----AASRPSAYKTSSCSSLQREPVSTAVTSL---RSLPKPQNQFLIQDFSLQ 853
Cdd:PHA03379 562 GIVRVRerwRPAPWTPNPPRSPSQMSvrdrlARLRAEAQPYQASVEVQPPQLTQVSPQQpmeYPLEPEQQMFPGSPFSQV 641
                        170
                 ....*....|
gi 122937341 854 PRPWRKPTVP 863
Cdd:PHA03379 642 ADVMRAGGVP 651
PTZ00108 PTZ00108
DNA topoisomerase 2-like protein; Provisional
497-718 8.66e-03

DNA topoisomerase 2-like protein; Provisional


Pssm-ID: 240271  Cd Length: 1388  Bit Score: 39.64  E-value: 8.66e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  497 DQVRKNKHKASEPIQGApKAKIQPKNPECLLEREVVVGSATVSNSASVNKAK---HSSNKPHKAASSRISKTKSHGQEKT 573
Cdd:PTZ00108 1148 EEKEIAKEQRLKSKTKG-KASKLRKPKLKKKEKKKKKSSADKSKKASVVGNSkrvDSDEKRKLDDKPDNKKSNSSGSDQE 1226
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122937341  574 KGNRKNSSKKSEESKQSGKKVKVEEKQTIPNMKRKKNQPELSQKTLKKPrsslgmhmlESVQVFHALGKKIdMKTGFSSS 653
Cdd:PTZ00108 1227 DDEEQKTKPKKSSVKRLKSKKNNSSKSSEDNDEFSSDDLSKEGKPKNAP---------KRVSAVQYSPPPP-SKRPDGES 1296
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 122937341  654 RTLGSSSNTQNRQPFPALKPWLDIQHEGKGPEKIQVKAQKLDGSAEKECTSPSHSELPPPGKVKL 718
Cdd:PTZ00108 1297 NGGSKPSSPTKKKVKKRLEGSLAALKKKKKSEKKTARKKKSKTRVKQASASQSSRLLRRPRKKKS 1361
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH