NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|118474005|ref|YP_890352|]
View 

magnesium or manganese-dependent protein phosphatase [Mycobacterium smegmatis str. MC2 155]

Protein Classification

fused response regulator/phosphatase (domain architecture ID 10068483)

fused response regulator/phosphatase contains a signal receiver REC domain that receives the signal from the sensor partner in a two-component systems, as well as a serine phosphatase domain similar to stage II sporulation protein E (SpoIIE), which is required for formation of a normal polar septum during sporulation

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
208-399 8.14e-29

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 284611  Cd Length: 190  Bit Score: 112.35  E-value: 8.14e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  208 DRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERMRQLDRILTTERPGkGIFATLCSVALEPDSGRFTVVRA 287
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEE-DMFATAVLAVYDPETGTLEYANA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  288 GH-PGLLVHGNGTVDWLEPRPGAALGLGAR-EWPVNHYELPEGHGLLLLTDGLFEGHAgRGDERLGESGLLAVARALAAT 365
Cdd:pfam07228  80 GHpPPLLLRPDGGVVELLESTGLPLGILPDaDYEVVELELEPGDTLLLYTDGLTEARD-PDGELFGLERLLALLAERHGL 158
                         170       180       190
                  ....*....|....*....|....*....|....
gi 118474005  366 PGRDFVTSLINEAESRAQthGGLSDDIAVIRVER 399
Cdd:pfam07228 159 PPEELLDALLEALLRLGG--GELEDDITLLVLRV 190
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
26-140 1.99e-19

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 83.78  E-value: 1.99e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  26 LLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLN 105
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKE-GYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHG 79
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 118474005 106 DEHFGVSAVASGAQDYLVKGrVEPEMLRRAVLYAI 140
Cdd:cd00156   80 DDEDAVEALKAGADDYLTKP-FSPEELLARIRALL 113
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
208-399 8.14e-29

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 112.35  E-value: 8.14e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  208 DRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERMRQLDRILTTERPGkGIFATLCSVALEPDSGRFTVVRA 287
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEE-DMFATAVLAVYDPETGTLEYANA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  288 GH-PGLLVHGNGTVDWLEPRPGAALGLGAR-EWPVNHYELPEGHGLLLLTDGLFEGHAgRGDERLGESGLLAVARALAAT 365
Cdd:pfam07228  80 GHpPPLLLRPDGGVVELLESTGLPLGILPDaDYEVVELELEPGDTLLLYTDGLTEARD-PDGELFGLERLLALLAERHGL 158
                         170       180       190
                  ....*....|....*....|....*....|....
gi 118474005  366 PGRDFVTSLINEAESRAQthGGLSDDIAVIRVER 399
Cdd:pfam07228 159 PPEELLDALLEALLRLGG--GELEDDITLLVLRV 190
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
26-140 1.99e-19

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 83.78  E-value: 1.99e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  26 LLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLN 105
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKE-GYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHG 79
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 118474005 106 DEHFGVSAVASGAQDYLVKGrVEPEMLRRAVLYAI 140
Cdd:cd00156   80 DDEDAVEALKAGADDYLTKP-FSPEELLARIRALL 113
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
18-146 1.76e-18

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 81.81  E-value: 1.76e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  18 PGQRRLSLLLVEDDRADAILVEELIADApDIDFVWAKSMSDA--ERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDAR 95
Cdd:COG0784    1 LLLSGLRVLVVDDEPVNRRLLKRLLEDL-GYEVVEAADGEEEalELLRELPQPDLILLDINMPGMDGIELLRRLRARGPN 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 118474005  96 IPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRAVLYAIERKRAE 146
Cdd:COG0784   80 IPVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
163-353 4.31e-16

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 78.98  E-value: 4.31e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005 163 ARLERGLLPSPLLMEGsGVDIVVEARPSRQhalIGGDFYDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFA 242
Cdd:COG2208  132 RQIQQNLLPKALPLFP-GIDIEAILVPASE---VGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLES 207
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005 243 GLRgnERMRQLDRILTT--ERPGKGIFATLCSVALEPDSGRFTVVRAGH-PGLLVHGNG--TVDWLEPRpGAALGLGAR- 316
Cdd:COG2208  208 GPL--DPADVLETLNRVlkQNLEEDMFVTLFLGVYDLDSGELTYSNAGHePALILSADGeiEVEDLTAL-GLPIGLLPDy 284
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 118474005 317 EWPVNHYELPEGHGLLLLTDGLFEGHAG----RGDERLGES 353
Cdd:COG2208  285 QYEVASLQLEPGDLLVLYTDGVTEARNSdgefFGLERLLKI 325
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
26-136 2.81e-14

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 306560  Cd Length: 111  Bit Score: 69.49  E-value: 2.81e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   26 LLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLN 105
Cdd:pfam00072   2 LIVDDDPLIRELLRQLLEKE-GYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPTTPVIILTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 118474005  106 DEHFGVSAVASGAQDYLVKgRVEPEMLRRAV 136
Cdd:pfam00072  81 DEDDAVEALEAGADDFLSK-PFDPDELLAAI 110
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
196-340 5.94e-12

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 64.29  E-value: 5.94e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   196 IGGDFYDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERMRQLDRILtTERPGKGIFATLCSVAL 275
Cdd:smart00331  16 VGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAI-YENGEDGMFATLFLALY 94
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005   276 EPDSGRFTVVRAGH-PGLLVH-GNGTVDWLEpRPGAALGLG-AREWPVNHYELPEGHGLLLLTDGLFE 340
Cdd:smart00331  95 DFAGGTLSYANAGHsPPYLLRaDGGLVEDLD-DLGAPLGLEpDVEVDVRELTLEPGDLLLLYTDGLTE 161
dpiA PRK10046
two-component response regulator DpiA; Provisional
23-172 2.79e-11

two-component response regulator DpiA; Provisional


Pssm-ID: 182208  Cd Length: 225  Bit Score: 62.73  E-value: 2.79e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLgkLDARIP--II 99
Cdd:PRK10046   5 LTLLIVEDETPLAEMHAEYIRHIPGFSQILlAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHEL--VQAHYPgdVV 82
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005 100 VLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAIERKRAeLTSVDlHASQLRAQE----NARLE-RGLLPS 172
Cdd:PRK10046  83 FTTAASDMETVSEAVRCGVFDYLIK-PIAYERLGQTLTRFRQRKHM-LESID-SASQKQIDEmfnaYARGEpKDELPT 157
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
25-174 1.95e-09

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209  Cd Length: 226  Bit Score: 57.34  E-value: 1.95e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   25 LLLVEDDRAdailVEELIA---DAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGK--LDARIPII 99
Cdd:TIGR02154   5 ILVVEDEPA----IRELIAynlEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRrpETRAIPII 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005  100 VLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRR--AVLyaiERKRAELTSVDLHASQLRAQENA-RLERGLLPSPL 174
Cdd:TIGR02154  81 MLTARGEEEDRVRGLETGADDYITKPFSPRELLARikAVL---RRIRPQLSDEVIEVGDLSLDPVAhRVFRGGQPLSL 155
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
23-78 8.57e-05

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 41.01  E-value: 8.57e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 118474005    23 LSLLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLP 78
Cdd:smart00448   1 MRILVVDDDPLLRELLKALLEKE-GYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
208-399 8.14e-29

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 112.35  E-value: 8.14e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  208 DRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERMRQLDRILTTERPGkGIFATLCSVALEPDSGRFTVVRA 287
Cdd:pfam07228   1 DGRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEE-DMFATAVLAVYDPETGTLEYANA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  288 GH-PGLLVHGNGTVDWLEPRPGAALGLGAR-EWPVNHYELPEGHGLLLLTDGLFEGHAgRGDERLGESGLLAVARALAAT 365
Cdd:pfam07228  80 GHpPPLLLRPDGGVVELLESTGLPLGILPDaDYEVVELELEPGDTLLLYTDGLTEARD-PDGELFGLERLLALLAERHGL 158
                         170       180       190
                  ....*....|....*....|....*....|....
gi 118474005  366 PGRDFVTSLINEAESRAQthGGLSDDIAVIRVER 399
Cdd:pfam07228 159 PPEELLDALLEALLRLGG--GELEDDITLLVLRV 190
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
26-140 1.99e-19

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 83.78  E-value: 1.99e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  26 LLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLN 105
Cdd:cd00156    1 LIVDDDPLIRELLRRLLEKE-GYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHG 79
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 118474005 106 DEHFGVSAVASGAQDYLVKGrVEPEMLRRAVLYAI 140
Cdd:cd00156   80 DDEDAVEALKAGADDYLTKP-FSPEELLARIRALL 113
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
18-146 1.76e-18

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 81.81  E-value: 1.76e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  18 PGQRRLSLLLVEDDRADAILVEELIADApDIDFVWAKSMSDA--ERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDAR 95
Cdd:COG0784    1 LLLSGLRVLVVDDEPVNRRLLKRLLEDL-GYEVVEAADGEEEalELLRELPQPDLILLDINMPGMDGIELLRRLRARGPN 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 118474005  96 IPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRAVLYAIERKRAE 146
Cdd:COG0784   80 IPVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRLLARAAAE 130
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
163-353 4.31e-16

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118  Cd Length: 367  Bit Score: 78.98  E-value: 4.31e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005 163 ARLERGLLPSPLLMEGsGVDIVVEARPSRQhalIGGDFYDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFA 242
Cdd:COG2208  132 RQIQQNLLPKALPLFP-GIDIEAILVPASE---VGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLES 207
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005 243 GLRgnERMRQLDRILTT--ERPGKGIFATLCSVALEPDSGRFTVVRAGH-PGLLVHGNG--TVDWLEPRpGAALGLGAR- 316
Cdd:COG2208  208 GPL--DPADVLETLNRVlkQNLEEDMFVTLFLGVYDLDSGELTYSNAGHePALILSADGeiEVEDLTAL-GLPIGLLPDy 284
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 118474005 317 EWPVNHYELPEGHGLLLLTDGLFEGHAG----RGDERLGES 353
Cdd:COG2208  285 QYEVASLQLEPGDLLVLYTDGVTEARNSdgefFGLERLLKI 325
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
24-147 4.41e-15

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114  Cd Length: 464  Bit Score: 76.58  E-value: 4.41e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  24 SLLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTG 103
Cdd:COG2204    6 RILVVDDDPDIRELLEQALELA-GYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTG 84
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 118474005 104 LNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAIERKRAEL 147
Cdd:COG2204   85 HGDIDTAVEALRLGAFDFLEK-PFDLDRLLAIVERALELRELQR 127
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
26-136 2.81e-14

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 306560  Cd Length: 111  Bit Score: 69.49  E-value: 2.81e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   26 LLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLN 105
Cdd:pfam00072   2 LIVDDDPLIRELLRQLLEKE-GYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPTTPVIILTAHG 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 118474005  106 DEHFGVSAVASGAQDYLVKgRVEPEMLRRAV 136
Cdd:pfam00072  81 DEDDAVEALEAGADDFLSK-PFDPDELLAAI 110
CitB COG2197
DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal ...
25-136 7.84e-13

DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 225107  Cd Length: 211  Bit Score: 66.94  E-value: 7.84e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRADAILVEELIADAPDIDfVW--AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLT 102
Cdd:COG2197    3 VLIVDDHPLVREGLRQLLELEPDLE-VVgeASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLT 81
                         90       100       110
                 ....*....|....*....|....*....|....
gi 118474005 103 GLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAV 136
Cdd:COG2197   82 AHDDPAYVIRALRAGADGYLLK-DASPEELVEAI 114
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
21-167 3.17e-12

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971  Cd Length: 360  Bit Score: 67.38  E-value: 3.17e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  21 RRLSLLLVEDDRADAILVEELIADAPdIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGID---ALHHLGKLDARIP 97
Cdd:COG3437   13 EKLTVLLVDDEPDNLEALRQLLRMIG-YRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEvlnKLKAMSPSTRRIP 91
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  98 IIVLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAIERKRAEltsvDLHASQLRAQENARLER 167
Cdd:COG3437   92 VILLTAYADSEDRQRALEAGADDYLSK-PISPKELVARVSSHLQLKRNE----DFLLDQNLYLELQELRR 156
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
196-340 5.94e-12

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 64.29  E-value: 5.94e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   196 IGGDFYDVVQTPDRTVHVMIGDVAGHGPDEAALGVALRIGWRALTFAGLRGNERMRQLDRILtTERPGKGIFATLCSVAL 275
Cdd:smart00331  16 VGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAI-YENGEDGMFATLFLALY 94
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005   276 EPDSGRFTVVRAGH-PGLLVH-GNGTVDWLEpRPGAALGLG-AREWPVNHYELPEGHGLLLLTDGLFE 340
Cdd:smart00331  95 DFAGGTLSYANAGHsPPYLLRaDGGLVEDLD-DLGAPLGLEpDVEVDVRELTLEPGDLLLLYTDGLTE 161
FixJ COG4566
Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal ...
53-194 6.27e-12

Two-component response regulator, FixJ family, consists of REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226932  Cd Length: 202  Bit Score: 64.23  E-value: 6.27e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  53 AKSMSDAERTLADHRPD---CVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVKgRVEP 129
Cdd:COG4566   31 VKCFASAEEFLAAAPLDrpgCLLLDVRMPGMSGLELQDRLAERGIRLPVIFLTGHGDIPMAVQAMKAGAVDFLEK-PFSE 109
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 118474005 130 EMLRRAVLYAIERKRAELTSVDL-HASQLRAQENARLERGLLpspllmegsgvDIVVEARPSRQHA 194
Cdd:COG4566  110 QDLLDAVERALARDASRRAEADRqAAIRARLATLTPRERQVL-----------DLVVRGLMNKQIA 164
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms] ...
23-174 7.74e-12

Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms];


Pssm-ID: 226931  Cd Length: 224  Bit Score: 64.20  E-value: 7.74e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVL 101
Cdd:COG4565    1 INVLIIEDDPMVAEIHRRYVKQIPGFSVVGtAGTLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELRSQHYPVDVIVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005 102 TGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAvLYAIERKRAELTSVD---------LHASQLRAQENARLERGLLPS 172
Cdd:COG4565   81 TAASDMETIKEALRYGVVDYLIK-PFTFERLQQA-LTRYRQKRHALESHQqlsqkeldqLFNIQSKEQPPDDLPKGLDEL 158

                 ..
gi 118474005 173 PL 174
Cdd:COG4565  159 TL 160
dpiA PRK10046
two-component response regulator DpiA; Provisional
23-172 2.79e-11

two-component response regulator DpiA; Provisional


Pssm-ID: 182208  Cd Length: 225  Bit Score: 62.73  E-value: 2.79e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLgkLDARIP--II 99
Cdd:PRK10046   5 LTLLIVEDETPLAEMHAEYIRHIPGFSQILlAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHEL--VQAHYPgdVV 82
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005 100 VLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAIERKRAeLTSVDlHASQLRAQE----NARLE-RGLLPS 172
Cdd:PRK10046  83 FTTAASDMETVSEAVRCGVFDYLIK-PIAYERLGQTLTRFRQRKHM-LESID-SASQKQIDEmfnaYARGEpKDELPT 157
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
38-167 9.76e-11

transcriptional regulator NarL; Provisional


Pssm-ID: 182619  Cd Length: 216  Bit Score: 60.81  E-value: 9.76e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  38 VEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHL--GKLDARipIIVLTGLNDEHFGVSAV 114
Cdd:PRK10651  22 VKQLISMAPDITVVGeASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLreKSLSGR--IVVFSVSNHEEDVVTAL 99
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005 115 ASGAQDYLVKGrVEPEMLRRAVLYAIERK---------------RAELTSVDLHASQLRAQENARLER 167
Cdd:PRK10651 100 KRGADGYLLKD-MEPEDLLKALQQAAAGEmvlsealtpvlaaslRANRATTERDVNQLTPRERDILKL 166
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
25-124 2.81e-10

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816  Cd Length: 229  Bit Score: 59.62  E-value: 2.81e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERtLADHRPDCVLLDLNLPDAAGIDALHHL-GKLDARIPIIVLTG 103
Cdd:COG0745    3 ILLVEDDPELAELLKEYLEEE-GYEVDVAADGEEALE-AAREQPDLVLLDLMLPDLDGLELCRRLrAKKGSGPPIIVLTA 80
                         90       100
                 ....*....|....*....|.
gi 118474005 104 LNDEHFGVSAVASGAQDYLVK 124
Cdd:COG0745   81 RDDEEDRVLGLEAGADDYLTK 101
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
22-124 9.04e-10

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099  Cd Length: 457  Bit Score: 59.86  E-value: 9.04e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  22 RLSLLLVEDDRAdailVEELIADA---PDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPI 98
Cdd:PRK11361   4 INRILIVDDEDN----VRRMLSTAfalQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPV 79
                         90       100
                 ....*....|....*....|....*.
gi 118474005  99 IVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK11361  80 ILMTAYAEVETAVEALRCGAFDYVIK 105
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
25-174 1.95e-09

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209  Cd Length: 226  Bit Score: 57.34  E-value: 1.95e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   25 LLLVEDDRAdailVEELIA---DAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGK--LDARIPII 99
Cdd:TIGR02154   5 ILVVEDEPA----IRELIAynlEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRrpETRAIPII 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 118474005  100 VLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRR--AVLyaiERKRAELTSVDLHASQLRAQENA-RLERGLLPSPL 174
Cdd:TIGR02154  81 MLTARGEEEDRVRGLETGADDYITKPFSPRELLARikAVL---RRIRPQLSDEVIEVGDLSLDPVAhRVFRGGQPLSL 155
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
22-167 7.77e-09

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species. [Cellular processes, Sporulation and germination]


Pssm-ID: 131922  Cd Length: 262  Bit Score: 55.95  E-value: 7.77e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   22 RLSLLLVEDDRADAILVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLG--KLDARIPI 98
Cdd:TIGR02875   2 KIRIVIADDNKEFCNLLKEYLAAQPDMEVVGvAHNGVDALELIKEQQPDVVVLDIIMPHLDGIGVLEKLNeiELSARPRV 81
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 118474005   99 IVLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVlyaieRKRAELTSVDLHASQLRAQENARLER 167
Cdd:TIGR02875  82 IMLSAFGQEKITQRAVALGADYYVLK-PFDLEILAARI-----RQLAWGTNADILADSPTVPPASHAAK 144
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
23-164 1.19e-08

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229  Cd Length: 435  Bit Score: 56.18  E-value: 1.19e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPdIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDaagIDALHHLGKL-----DARIP 97
Cdd:COG3706  133 KKILVVDDDATQRERLRRILQVEG-FRVVEATDGEEALLQLAELPPDLVLLDANMPD---MDGLELCTRLrqlerTRDIP 208
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 118474005  98 IIVLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAIERKRAEltsVDLHASQLRAQENAR 164
Cdd:COG3706  209 IILLSSKDDDELVVRAFELGVNDYITK-PIEEGELRARLRRQLRRKRYE---RQLRESLERLQELAL 271
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
64-124 1.94e-08

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522  Cd Length: 225  Bit Score: 54.43  E-value: 1.94e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 118474005  64 ADHRPDCVLLDLNLPDAAGIDALHHLGKLDArIPIIVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK10529  42 ATRKPDLIILDLGLPDGDGIEFIRDLRQWSA-IPVIVLSARSEESDKIAALDAGADDYLSK 101
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
25-124 1.56e-07

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 273818  Cd Length: 463  Bit Score: 52.82  E-value: 1.56e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   25 LLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGL 104
Cdd:TIGR01818   1 VWVVDDDRSIRWVLEKALSRA-GYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAH 79
                          90       100
                  ....*....|....*....|
gi 118474005  105 NDEHFGVSAVASGAQDYLVK 124
Cdd:TIGR01818  80 SDLDTAVAAYQRGAFEYLPK 99
fixJ PRK09390
response regulator FixJ; Provisional
62-146 2.25e-07

response regulator FixJ; Provisional


Pssm-ID: 181815  Cd Length: 202  Bit Score: 50.77  E-value: 2.25e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  62 TLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVK---GRVEPEMLRRAVLY 138
Cdd:PRK09390  42 ALPGLRFGCVVTDVRMPGIDGIELLRRLKARGSPLPVIVMTGHGDVPLAVEAMKLGAVDFIEKpfeDERLIGAIERALAQ 121

                 ....*...
gi 118474005 139 AIERKRAE 146
Cdd:PRK09390 122 APEAAKSE 129
SAPR COG3947
Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal ...
23-149 6.26e-07

Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226456  Cd Length: 361  Bit Score: 50.63  E-value: 6.26e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIdFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLT 102
Cdd:COG3947    1 PRIIIVDDDAAIVKLLSVILSRAGHE-VRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFIS 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 118474005 103 GLNDehFGVSAVASGAQDYLVKgRVEPEMLRRAVLYAieRKRAELTS 149
Cdd:COG3947   80 SHAE--YADDSFGMNLDDYLPK-PVTPEKLNRAIDRR--LKRVELTA 121
PRK15369 PRK15369
two component system sensor kinase SsrB; Provisional
65-124 7.08e-07

two component system sensor kinase SsrB; Provisional


Pssm-ID: 185267  Cd Length: 211  Bit Score: 49.31  E-value: 7.08e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 118474005  65 DHRPDCVLLDLNLPdaaGIDALHHLGKLDARIP---IIVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK15369  47 QLEPDIVILDLGLP---GMNGLDVIPQLHQRWPamnILVLTARQEEHMASRTLAAGALGYVLK 106
LytT COG3279
DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction ...
23-166 9.91e-07

DNA-binding response regulator, LytR/AlgR family [Transcription, Signal transduction mechanisms];


Pssm-ID: 225818  Cd Length: 244  Bit Score: 49.28  E-value: 9.91e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVWAKSM-SDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVL 101
Cdd:COG3279    2 LKVLIVDDEPLAREELRRILNEIPDIEIVGEAENgEEALQLLQGLRPDLVFLDIAMPDINGIELAARIRKGDPRPAIVFV 81
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 118474005 102 TGLND---EHFGVSAVasgaqDYLVK-GRVEP--EMLRRAVLYAIERKRAELTSVDLHASQLRAQENARLE 166
Cdd:COG3279   82 TAHDEyavAAFEVEAL-----DYLLKpISEERlaKTLERLRRYAQLQLLELLADTEKVLRFIPIKGGERII 147
PRK09483 PRK09483
response regulator; Provisional
23-136 2.39e-06

response regulator; Provisional


Pssm-ID: 236538  Cd Length: 217  Bit Score: 47.79  E-value: 2.39e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVL 101
Cdd:PRK09483   2 INVLLVDDHELVRAGIRRILEDIKGIKVVGeACCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRYTPDVKIIML 81
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 118474005 102 TGLNDEHFGVSAVASGAQDYLVKGRVEPEMLR--RAV 136
Cdd:PRK09483  82 TVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSaiRSV 118
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
25-158 4.65e-06

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158). [Regulatory functions, DNA interactions]


Pssm-ID: 274348  Cd Length: 445  Bit Score: 48.21  E-value: 4.65e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   25 LLLVEDDRAdaiLVEELIADAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLP-DAA----GIDALHHLGKLDARIPII 99
Cdd:TIGR02915   1 LLIVEDDLG---LQKQLKWSFADYELAVAADRESAIALVRRHEPAVVTLDLGLPpDADgaseGLAALQQILAIAPDTKVI 77
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 118474005  100 VLTGLNDEHFGVSAVASGAQDYLVKgRVEPEMLRRAV-----LYAIERKRAELTSVdLHASQLR 158
Cdd:TIGR02915  78 VITGNDDRENAVKAIGLGAYDFYQK-PIDPDVLKLIVdrafhLYTLETENRRLQSA-LGGTALR 139
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
22-124 4.65e-06

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412  Cd Length: 441  Bit Score: 48.10  E-value: 4.65e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  22 RLSLLLVEDDRADAILVEELIAdAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVL 101
Cdd:PRK10365   5 NIDILVVDDDISHCTILQALLR-GWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIM 83
                         90       100
                 ....*....|....*....|...
gi 118474005 102 TGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK10365  84 TAYSSVETAVEALKTGALDYLIK 106
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
18-89 7.66e-06

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362  Cd Length: 968  Bit Score: 47.85  E-value: 7.66e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 118474005   18 PGQRrlsLLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHL 89
Cdd:TIGR02956 701 PPQR---VLLVEDNEVNQMVAQGFLTRL-GHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQL 768
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
25-143 1.03e-05

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864  Cd Length: 232  Bit Score: 46.33  E-value: 1.03e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRADAILVEELIaDAPDIDFVWAksmSDAERTLA--DHRPDCVLLDLNLPDAAGIDALHHLgKLDARIPIIVLT 102
Cdd:PRK10955   4 ILLVDDDRELTSLLKELL-EMEGFNVIVA---HDGEQALDllDDSIDLLLLDVMMPKKNGIDTLKEL-RQTHQTPVIMLT 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 118474005 103 GLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRavLYAIERK 143
Cdd:PRK10955  79 ARGSELDRVLGLELGADDYLPKPFNDRELVAR--IRAILRR 117
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
25-124 1.14e-05

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095  Cd Length: 475  Bit Score: 46.97  E-value: 1.14e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRadaILVEELIA----DAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPII 99
Cdd:COG4753    4 VLIVDDEP---LIREGLKSlidwEALGIEVVGtAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEFI 80
                         90       100
                 ....*....|....*....|....*
gi 118474005 100 VLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:COG4753   81 ILSGYDEFEYAKKAMKLGVKDYLLK 105
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
25-124 3.08e-05

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612  Cd Length: 222  Bit Score: 44.64  E-value: 3.08e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDradAILVEELIADAPDIDFVW--AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLT 102
Cdd:PRK10643   3 ILIVEDD---TLLLQGLILALQTEGYACdcASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQKKYTLPVLILT 79
                         90       100
                 ....*....|....*....|....*
gi 118474005 103 G---LNDEhfgVSAVASGAQDYLVK 124
Cdd:PRK10643  80 ArdtLEDR---VAGLDVGADDYLVK 101
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
51-134 3.67e-05

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277  Cd Length: 229  Bit Score: 44.71  E-value: 3.67e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  51 VWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGK--LDARIPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVE 128
Cdd:PRK10161  30 VEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKResMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSP 109

                 ....*.
gi 118474005 129 PEMLRR 134
Cdd:PRK10161 110 KELVAR 115
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
53-124 4.95e-05

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755  Cd Length: 223  Bit Score: 43.96  E-value: 4.95e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 118474005  53 AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK10816  30 AEDAKEADYYLNEHLPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTK 101
AmiR COG3707
Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding ...
23-170 8.10e-05

Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226230  Cd Length: 194  Bit Score: 43.09  E-value: 8.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  23 LSLLLVEDDRADAILVEELIADAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKlDARIPIIVLT 102
Cdd:COG3707    6 LRVLVADDEALTRMDIREGLLEAGYQRVGEAADGLEAVEVCERLQPDVVILDIEMPRRDIIEALLLASE-NVARPIVALT 84
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 118474005 103 GLNDEHFGVSAVASGAQDYLVKGrVEPEMLRRAVlyAIERKRAELTS---VDLHASQLRAQENARLER--GLL 170
Cdd:COG3707   85 AYSDPALIEAAIEAGVMAYIVKP-LDESRLLPIL--DVAVSRFEERRalrRELAKLKDRLEERKVIERakGLL 154
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
23-78 8.57e-05

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 41.01  E-value: 8.57e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 118474005    23 LSLLLVEDDRADAILVEELIADApDIDFVWAKSMSDAERTLADHRPDCVLLDLNLP 78
Cdd:smart00448   1 MRILVVDDDPLLRELLKALLEKE-GYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
69-157 1.08e-04

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102  Cd Length: 227  Bit Score: 42.99  E-value: 1.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  69 DCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRRaVLYAIERKRAELT 148
Cdd:PRK09836  46 DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLAR-VRTLLRRGAAVII 124

                 ....*....
gi 118474005 149 SVDLHASQL 157
Cdd:PRK09836 125 ESQFQVADL 133
PRK10693 PRK10693
response regulator of RpoS; Provisional
57-137 1.42e-04

response regulator of RpoS; Provisional


Pssm-ID: 182652  Cd Length: 303  Bit Score: 43.06  E-value: 1.42e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  57 SDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDehfgVSAVAS----GAQDYLVKGRVEPEML 132
Cdd:PRK10693   7 VDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGDQTPVLVISATEN----MADIAKalrlGVQDVLLKPVKDLNRL 82

                 ....*
gi 118474005 133 RRAVL 137
Cdd:PRK10693  83 REMVF 87
PRK10701 PRK10701
DNA-binding transcriptional regulator RstA; Provisional
25-124 1.62e-04

DNA-binding transcriptional regulator RstA; Provisional


Pssm-ID: 236738  Cd Length: 240  Bit Score: 42.70  E-value: 1.62e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRAdailVEELIAD---APDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPdaaGIDALHHLGKLDARI--PII 99
Cdd:PRK10701   4 IVFVEDDAE----VGSLIAAylaKHDIDVTVEPRGDRAEATILREQPDLVLLDIMLP---GKDGMTICRDLRPKWqgPIV 76
                         90       100
                 ....*....|....*....|....*
gi 118474005 100 VLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK10701  77 LLTSLDSDMNHILALEMGACDYILK 101
COG4567 COG4567
Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains ...
24-124 2.70e-04

Two-component response regulator, ActR/RegA family, consists of REC and Fis-type HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226933  Cd Length: 182  Bit Score: 41.25  E-value: 2.70e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  24 SLLLVEDDRADAILVEELIaDAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTG 103
Cdd:COG4567   11 SLLLVDDDTPFLRTLARAM-ERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGLAVIEALRERRADMRIVVLTG 89
                         90       100
                 ....*....|....*....|.
gi 118474005 104 LNDEHFGVSAVASGAQDYLVK 124
Cdd:COG4567   90 YASIATAVEAVKLGACDYLAK 110
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
25-124 6.95e-04

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838  Cd Length: 228  Bit Score: 40.72  E-value: 6.95e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRADA-ILVEELIADAPDIDfvWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTG 103
Cdd:PRK11083   6 ILLVEDEQAIAdTLVYALQSEGFTVE--WFERGLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAFHPALPVIFLTA 83
                         90       100
                 ....*....|....*....|.
gi 118474005 104 LNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK11083  84 RSDEVDRLVGLEIGADDYVAK 104
marine_sort_RR TIGR03787
proteobacterial dedicated sortase system response regulator; This model describes a family of ...
57-134 1.20e-03

proteobacterial dedicated sortase system response regulator; This model describes a family of DNA-binding response regulator proteins, associated with an adjacent histidine kinase (TIGR03785) to form a two-component system. This system co-occurs with, and often is adjacent to, a proteobacterial variant form of the protein sorting transpeptidase called sortase (TIGR03784), and a single target protein for the sortase. We give this protein the gene symbol pdsR, for Proteobacterial Dedicated Sortase system Response regulator.


Pssm-ID: 163499  Cd Length: 227  Bit Score: 40.12  E-value: 1.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005   57 SDAERTLADHRPDCVLLDLNLPDAA--GIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRR 134
Cdd:TIGR03787  34 PSAMQAFRQRLPDLAIIDIGLGEEIdgGFMLCQDLRSLSATLPIIFLTARDSDFDTVSGLRLGADDYLTKDISLPHLLAR 113
CheB COG2201
Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains ...
37-104 1.22e-03

Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains [Cell motility, Signal transduction mechanisms];


Pssm-ID: 225111  Cd Length: 350  Bit Score: 40.35  E-value: 1.22e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 118474005  37 LVEELIADAPDIDFVW-AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLdARIPIIVLTGL 104
Cdd:COG2201   16 VISDILNSDPDIEVVGtARNGREAIDKVKKLKPDVITLDVEMPVMDGLEALRKIMRL-RPLPVIMVSSL 83
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
63-124 1.36e-03

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842  Cd Length: 469  Bit Score: 40.62  E-value: 1.36e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 118474005  63 LADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK10923  43 LASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK 104
orf27 CHL00148
Ycf27; Reviewed
66-151 1.49e-03

Ycf27; Reviewed


Pssm-ID: 214376  Cd Length: 240  Bit Score: 39.70  E-value: 1.49e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  66 HRPDCVLLDLNLPDAAGIDALHHLGKlDARIPIIVLTGLNDEHFGVSAVASGAQDYLVK--GRVEPEMLRRAVLYAIERK 143
Cdd:CHL00148  49 EQPDLVILDVMMPKLDGYGVCQEIRK-ESDVPIIMLTALGDVSDRITGLELGADDYVVKpfSPKELEARIRSVLRRTNKK 127

                 ....*...
gi 118474005 144 RAELTSVD 151
Cdd:CHL00148 128 SFSSKIPN 135
pleD PRK09581
response regulator PleD; Reviewed
53-124 2.10e-03

response regulator PleD; Reviewed


Pssm-ID: 236577  Cd Length: 457  Bit Score: 39.88  E-value: 2.10e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 118474005  53 AKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLgKLDAR---IPIIVLTGLNDEHFGVSAVASGAQDYLVK 124
Cdd:PRK09581  32 ASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRL-KSDPAtthIPVVMVTALDDPEDRVRGLEAGADDFLTK 105
ompR PRK09468
osmolarity response regulator; Provisional
19-137 3.23e-03

osmolarity response regulator; Provisional


Pssm-ID: 181883  Cd Length: 239  Bit Score: 38.80  E-value: 3.23e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  19 GQRRLSLLLVEDD-RADAILVEELIADAPDIdfvwaKSMSDAE---RTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDA 94
Cdd:PRK09468   2 MQENYKILVVDDDmRLRALLERYLTEQGFQV-----RSAANAEqmdRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQNN 76
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 118474005  95 RIPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRR--AVL 137
Cdd:PRK09468  77 PTPIIMLTAKGEEVDRIVGLEIGADDYLPKPFNPRELLARirAVL 121
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
68-186 3.78e-03

transcriptional regulator NarP; Provisional


Pssm-ID: 182431  Cd Length: 215  Bit Score: 38.29  E-value: 3.78e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  68 PDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTgLNDEHFGVSA-VASGAQDYLVKGRvEPEMLRRAVlyaierkRAE 146
Cdd:PRK10403  53 PDVILLDLNMKGMSGLDTLNALRRDGVTAQIIILT-VSDASSDVFAlIDAGADGYLLKDS-DPEVLLEAI-------RAG 123
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 118474005 147 LTSVDLHASQLRAQENARLERGLLPSPL-LMEGSGVDIVVE 186
Cdd:PRK10403 124 AKGSKVFSERVNQYLREREMFGAEEDPFsVLTERELDVLHE 164
PRK13558 PRK13558
bacterio-opsin activator; Provisional
25-163 4.02e-03

bacterio-opsin activator; Provisional


Pssm-ID: 237426  Cd Length: 665  Bit Score: 39.05  E-value: 4.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474005  25 LLLVEDDRADAIlVEELIADAPDIDFVWAKSMSDAERTLADHRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGL 104
Cdd:PRK13558  10 VLFVGDDPEAGP-VDCDLDEDGRLDVTQIRDFVAARDRVEAGEIDCVVADHEPDGFDGLALLEAVRQTTAVPPVVVVPTA 88
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 118474005 105 NDEHFGVSAVASGAQDYL------VKGRVEPEMLRRAVLYAIERKRAELTSVDLHASQLRAQENA 163
Cdd:PRK13558  89 GDEAVARRAVDADAAAYVpavsddATAAIAERIESAVPEHSRDTEARMPISDLTVESDRRLKERA 153
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
66-134 4.20e-03

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions]


Pssm-ID: 130454  Cd Length: 218  Bit Score: 38.24  E-value: 4.20e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 118474005   66 HRPDCVLLDLNLPDAAGIDALHHLGKLDARIPIIVLTGLNDEHFGVSAVASGAQDYLVKGRVEPEMLRR 134
Cdd:TIGR01387  41 DDYDLIILDVMLPGMDGWQILQTLRRSGKQTPVLFLTARDSVADKVKGLDLGADDYLVKPFSFSELLAR 109
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH