NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|115495235|ref|NP_001069317|]
View 

insulin-degrading enzyme precursor [Bos taurus]

Protein Classification

peptidase M16 (domain architecture ID 11437003)

peptidase M16 is a zinc-dependent peptidase that cleaves small peptides close to a terminus, often including bonds on the amino side of basic residues such as arginine

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ptr COG1025
Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, ...
54-958 0e+00

Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones];


:

Pssm-ID: 223956  Cd Length: 937  Bit Score: 790.80  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   54 IIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSE 133
Cdd:COG1025    14 IHKPALDDRKYRAIKLPNGLRALLVSDPQADKSSAALVVPVGSFDDPEEYPGLAHFLEHMLFMGSEKYPDEGGFSEFLSK 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  134 HAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKH 213
Cdd:COG1025    94 HGGSHNASTAGERTAFYFEVENDALEGALDRFADFFIEPLFNKEALDRERNAVNSEFTMNLTSDGWRMYQVQALTANPGH 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  214 PFSKFGTGNKYTLETRPnqeGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPF 293
Cdd:COG1025   174 PLSKFSTGNLETLSDKP---GLVVQQELKEFHEKHYSANNMKLVIYGNQPLDELAKLAADLFGDIPNRARKIPPIPVPVV 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  294 QEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQKEGARGFMFF 373
Cdd:COG1025   251 TDEQTGKIIHIVPAKPRPRLRIYFPIDDNSAKFRSKPDEYLSHLIGNESPGSLLAWLKKQGLITELSAGLDPISGNYGVF 330
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  374 IINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE 453
Cdd:COG1025   331 AISYELTDKGLAHYDRVIALTFQYLNLLREKGIPKYTFDELQNVLDLDFRYPSKTRPMDYVSWLADNMEREPVEHTLYAS 410
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  454 YLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEgkTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPMKNEFIPT 533
Cdd:COG1025   411 LVLPRYDPKAIQERLALMTPENARLWLISKLEE--HDKAAYFYGFPYQVDDYTAQPLDAWQQKADSIELSLPEPNPFIPD 488
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  534 NFEiLSLEKEATPYPSLIKDTAMSKLWFKQDDKFF-LPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAE 612
Cdd:COG1025   489 DVS-LIKSEKKFTFPQLLSEDPNLRLWYLKEDYFAvEPKASVSLAIRSPHASRSPRNQVLTELYAYLANDALDKLSYQAS 567
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  613 LAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTE 692
Cdd:COG1025   568 LAGLSFSLAANSNGLDLTISGFTQRLPQLLRAFLDGLFSLPVDEDRFEQAKSQLSEELKNALTGKPYRQALDGLTGLLQV 647
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  693 VAWTKDELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALgimqmvedTLIEHAHTK-PLLPSQLVRYREVQL 771
Cdd:COG1025   648 PYWSREERRNALESVSVEEFAAFRDTLLNGVHLEMLVLGNLTEADAT--------NLAETLQKKlPAIGSTWYRNPSVYL 719
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  772 PDRGWFVY----QQRNEVhNNCgieIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLR 847
Cdd:COG1025   720 LKGGTRIFetvgGESDSA-NAA---ILYPQQYDEIKSSALSSLLGQLIHPWFFDQLRTKEQLGYAVFSGPREVGRTPGIG 795
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  848 FIIQSE-KPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVA 926
Cdd:COG1025   796 FLVQSNsKSPSYLLERINAFLETAEPELREMSEEDFEQIKKALINQILQPPQNLAEEASRLWKAFGRGNLDFDHREKKIE 875
                         890       900       910
                  ....*....|....*....|....*....|..
gi 115495235  927 YLKTLTKEDIIKFYKEmlAVDAPRRHKVSVHV 958
Cdd:COG1025   876 AVKTLTKQKLLDFFEN--ALSYEQGSKLLSHI 905
 
Name Accession Description Interval E-value
Ptr COG1025
Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, ...
54-958 0e+00

Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223956  Cd Length: 937  Bit Score: 790.80  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   54 IIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSE 133
Cdd:COG1025    14 IHKPALDDRKYRAIKLPNGLRALLVSDPQADKSSAALVVPVGSFDDPEEYPGLAHFLEHMLFMGSEKYPDEGGFSEFLSK 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  134 HAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKH 213
Cdd:COG1025    94 HGGSHNASTAGERTAFYFEVENDALEGALDRFADFFIEPLFNKEALDRERNAVNSEFTMNLTSDGWRMYQVQALTANPGH 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  214 PFSKFGTGNKYTLETRPnqeGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPF 293
Cdd:COG1025   174 PLSKFSTGNLETLSDKP---GLVVQQELKEFHEKHYSANNMKLVIYGNQPLDELAKLAADLFGDIPNRARKIPPIPVPVV 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  294 QEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQKEGARGFMFF 373
Cdd:COG1025   251 TDEQTGKIIHIVPAKPRPRLRIYFPIDDNSAKFRSKPDEYLSHLIGNESPGSLLAWLKKQGLITELSAGLDPISGNYGVF 330
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  374 IINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE 453
Cdd:COG1025   331 AISYELTDKGLAHYDRVIALTFQYLNLLREKGIPKYTFDELQNVLDLDFRYPSKTRPMDYVSWLADNMEREPVEHTLYAS 410
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  454 YLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEgkTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPMKNEFIPT 533
Cdd:COG1025   411 LVLPRYDPKAIQERLALMTPENARLWLISKLEE--HDKAAYFYGFPYQVDDYTAQPLDAWQQKADSIELSLPEPNPFIPD 488
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  534 NFEiLSLEKEATPYPSLIKDTAMSKLWFKQDDKFF-LPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAE 612
Cdd:COG1025   489 DVS-LIKSEKKFTFPQLLSEDPNLRLWYLKEDYFAvEPKASVSLAIRSPHASRSPRNQVLTELYAYLANDALDKLSYQAS 567
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  613 LAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTE 692
Cdd:COG1025   568 LAGLSFSLAANSNGLDLTISGFTQRLPQLLRAFLDGLFSLPVDEDRFEQAKSQLSEELKNALTGKPYRQALDGLTGLLQV 647
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  693 VAWTKDELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALgimqmvedTLIEHAHTK-PLLPSQLVRYREVQL 771
Cdd:COG1025   648 PYWSREERRNALESVSVEEFAAFRDTLLNGVHLEMLVLGNLTEADAT--------NLAETLQKKlPAIGSTWYRNPSVYL 719
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  772 PDRGWFVY----QQRNEVhNNCgieIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLR 847
Cdd:COG1025   720 LKGGTRIFetvgGESDSA-NAA---ILYPQQYDEIKSSALSSLLGQLIHPWFFDQLRTKEQLGYAVFSGPREVGRTPGIG 795
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  848 FIIQSE-KPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVA 926
Cdd:COG1025   796 FLVQSNsKSPSYLLERINAFLETAEPELREMSEEDFEQIKKALINQILQPPQNLAEEASRLWKAFGRGNLDFDHREKKIE 875
                         890       900       910
                  ....*....|....*....|....*....|..
gi 115495235  927 YLKTLTKEDIIKFYKEmlAVDAPRRHKVSVHV 958
Cdd:COG1025   876 AVKTLTKQKLLDFFEN--ALSYEQGSKLLSHI 905
PRK15101 PRK15101
protease3; Provisional
54-950 2.40e-147

protease3; Provisional


Pssm-ID: 185056  Cd Length: 961  Bit Score: 467.53  E-value: 2.40e-147
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   54 IIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSE 133
Cdd:PRK15101   34 IRKSEKDPRQYQAIRLDNGMTVLLVSDPQAVKSLAALALPVGSLEDPDAQQGLAHYLEHMVLMGSKKYPQPDSLAEFLKK 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  134 HAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKH 213
Cdd:PRK15101  114 HGGSHNASTASYRTAFYLEVENDALPPAVDRLADAIAEPLLDPKNADRERNAVNAELTMARSRDGMRMAQVSAETINPAH 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  214 PFSKFGTGNKYTLETRPNQEgidVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPF 293
Cdd:PRK15101  194 PGSRFSGGNLETLSDKPGSK---LQDALVDFYQRYYSANLMKAVIYSNQPLPELAKLAADTFGRVPNKNASVPEITVPVV 270
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  294 QEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQK---EGARGF 370
Cdd:PRK15101  271 TDAQKGIIIHYVPAQPRKVLRVEFRIDNNSAKFRSKTDEYISYLIGNRSPGTLSDWLQKQGLAEGISAGADpmvDRNSGV 350
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  371 mfFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVL 450
Cdd:PRK15101  351 --FAISVSLTDKGLAQRDQVVAAIFSYLNLLREKGIDKSYFDELAHVLDLDFRYPSITRDMDYIEWLADTMLRVPVEHTL 428
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  451 TAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKsfEGKTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPMKNEF 530
Cdd:PRK15101  429 DAPYIADRYDPKAIKARLAEMTPQNARIWYISP--QEPHNKTAYFVDAPYQVDKISEQTFADWQQKAQNIALSLPELNPY 506
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  531 IPTNFEILSLEKEATpYPSLIKDT------AMSKLWFKQDdkfflPKACLNFEFFSPFAYVDPLHCNMAYL--YLELLkd 602
Cdd:PRK15101  507 IPDDFSLIKADKAYK-HPELIVDEpglrvvYMPSQYFADE-----PKADISLVLRNPKAMDSARNQVLFALndYLAGL-- 578
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  603 SLNEYAYAAELAGLSYDLqNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHA 682
Cdd:PRK15101  579 ALDQLSNQASVGGISFST-NANNGLMVNANGYTQRLPQLLQALLEGYFSFTPTEEQLAQAKSWYREQLDSAEKGKAYEQA 657
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  683 MYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAAlgimqmveDTLIEHAHTK-PLLPS 761
Cdd:PRK15101  658 IMPAQMLSQVPYFERDERRKLLPSITLKDVLAYRDALLSGATPEFLVVGNLTEEQV--------TTLARDVQKQlGADGT 729
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  762 QLVRYREVQLPDRGWFVYQQRNEVHNNCGIEIYYQT---DMQSTSENMFLElfcQIISEPCFNTLRTKEQLGYIVFSGPR 838
Cdd:PRK15101  730 EWWRGKDVVVDKKQSVNFEKAGSSTDSALAAVYVPTgydEYQSSAYSSLLG---QIIQPWFYNQLRTEEQLGYAVFAFPM 806
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  839 RANGIQGLRFIIQS-EKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYN 917
Cdd:PRK15101  807 SVGRQWGMGFLLQSnDKQPAYLWQRYQAFFPQAEAKLRAMKPEEFAQYQQALINQLLQAPQTLGEEASRLSKDFDRGNMR 886
                         890       900       910
                  ....*....|....*....|....*....|....
gi 115495235  918 FD-RDNIeVAYLKTLTKEDIIKFYKEmlAVDAPR 950
Cdd:PRK15101  887 FDsRDKI-IAQIKLLTPQKLADFFHQ--AVIEPQ 917
Peptidase_M16_M pfam16187
Middle or third domain of peptidase_M16; Peptidase_M16_M is the third domain of peptidase_M16 ...
422-703 2.07e-134

Middle or third domain of peptidase_M16; Peptidase_M16_M is the third domain of peptidase_M16 in eukaryotes of the insulin-degrading-enzyme type. Insulin-degrading enzymes - insulysin - are zinc metallopeptidases that metabolize several bioactive peptides, including insulin and the amyloid-beta-peptide. The tertiary structure of insulin-degrading enzymes resembles a clamshell composed of four structurally similar domains arranged to enclose a large central chamber. Substrates must enter the chamber, and it is likely that a hinge-like conformational change allows substrate binding and product release. Triphosphates are found to dock between the inner surfaces of the non-catalytic domains three and four.


Pssm-ID: 318428  Cd Length: 284  Bit Score: 410.00  E-value: 2.07e-134
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   422 FRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTDRTEEWYGTQYK 501
Cdd:pfam16187    1 FRFKEKSPPSDYVSSLASNMQKYPPEDVLSGDYLLREYDPELIKELLDYLTPENARITLVSKEFEGETDKKEPWYGTEYS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   502 QEAIPDEVIKKWQNADL-NGKFKLPMKNEFIPTNFEILSLE-KEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFF 579
Cdd:pfam16187   81 VEKIPEELLKKWKNPEPsNPELHLPEPNPFIPTDFSLKKPEvEEPAKYPVLIRDTPGSRLWYKKDDTFWVPKAYIYLSLR 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   580 SPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRF 659
Cdd:pfam16187  161 SPLAYSSPKNAVLTRLYVELLKDSLNEYAYDAELAGLSYSLSATERGLTLSVSGYNDKLPVLLEKILEKLKNFEIDEDRF 240
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....
gi 115495235   660 EIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEA 703
Cdd:pfam16187  241 EIIKEQLLRALKNFKLEQPYQQAFYYLLYLLEERSWTPEEKLEA 284
PQQ_syn_pqqF TIGR02110
coenzyme PQQ biosynthesis probable peptidase PqqF; In a subset of species that make coenzyme ...
65-359 1.12e-33

coenzyme PQQ biosynthesis probable peptidase PqqF; In a subset of species that make coenzyme PQQ (pyrrolo-quinoline-quinone), this probable peptidase is found in the PQQ biosynthesis region and is thought to act as a protease on PqqA (TIGR02107), a probable peptide precursor of the coenzyme. PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]


Pssm-ID: 273978  Cd Length: 697  Bit Score: 138.85  E-value: 1.12e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235    65 RGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSG 144
Cdd:TIGR02110    1 RRITLPNGLRVHLYHQPDAKRAAALLRVAAGSHDEPSAWPGLAHFLEHLLFLGGERFQGDDRLMPWVQRQGGQVNATTLE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   145 EHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKnVMNDAWRLFQLEKATG-NPKHPFSKFGTGNK 223
Cdd:TIGR02110   81 RTTAFFFELPAAALAAGLARLCDMLARPLLTAEDQQREREVLEAEYIA-WQNDADTLREAALLDAlQAGHPLRRFHAGSR 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   224 YTLETrPNQEgidVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNvPLPEFPEHPFQEEHLKQLYK 303
Cdd:TIGR02110  160 DSLAL-PNTA---FQQALRDFHRRHYQAGNMQLWLQGPQSLDELEQLAARFGASLAAGG-ECAQAPPAPLLRFDRLTLAG 234
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 115495235   304 IVPikdiRNLYVTFPIPDLQKYYKSNPGhYLGHLIGHEGPGSLLSELKSKGWVNTL 359
Cdd:TIGR02110  235 GSE----PRLWLLFALAGLPATARDNVT-LLCEFLQDEAPGGLLAQLRERGLAESV 285
 
Name Accession Description Interval E-value
Ptr COG1025
Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, ...
54-958 0e+00

Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223956  Cd Length: 937  Bit Score: 790.80  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   54 IIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSE 133
Cdd:COG1025    14 IHKPALDDRKYRAIKLPNGLRALLVSDPQADKSSAALVVPVGSFDDPEEYPGLAHFLEHMLFMGSEKYPDEGGFSEFLSK 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  134 HAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKH 213
Cdd:COG1025    94 HGGSHNASTAGERTAFYFEVENDALEGALDRFADFFIEPLFNKEALDRERNAVNSEFTMNLTSDGWRMYQVQALTANPGH 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  214 PFSKFGTGNKYTLETRPnqeGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPF 293
Cdd:COG1025   174 PLSKFSTGNLETLSDKP---GLVVQQELKEFHEKHYSANNMKLVIYGNQPLDELAKLAADLFGDIPNRARKIPPIPVPVV 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  294 QEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQKEGARGFMFF 373
Cdd:COG1025   251 TDEQTGKIIHIVPAKPRPRLRIYFPIDDNSAKFRSKPDEYLSHLIGNESPGSLLAWLKKQGLITELSAGLDPISGNYGVF 330
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  374 IINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE 453
Cdd:COG1025   331 AISYELTDKGLAHYDRVIALTFQYLNLLREKGIPKYTFDELQNVLDLDFRYPSKTRPMDYVSWLADNMEREPVEHTLYAS 410
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  454 YLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEgkTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPMKNEFIPT 533
Cdd:COG1025   411 LVLPRYDPKAIQERLALMTPENARLWLISKLEE--HDKAAYFYGFPYQVDDYTAQPLDAWQQKADSIELSLPEPNPFIPD 488
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  534 NFEiLSLEKEATPYPSLIKDTAMSKLWFKQDDKFF-LPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAE 612
Cdd:COG1025   489 DVS-LIKSEKKFTFPQLLSEDPNLRLWYLKEDYFAvEPKASVSLAIRSPHASRSPRNQVLTELYAYLANDALDKLSYQAS 567
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  613 LAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTE 692
Cdd:COG1025   568 LAGLSFSLAANSNGLDLTISGFTQRLPQLLRAFLDGLFSLPVDEDRFEQAKSQLSEELKNALTGKPYRQALDGLTGLLQV 647
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  693 VAWTKDELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALgimqmvedTLIEHAHTK-PLLPSQLVRYREVQL 771
Cdd:COG1025   648 PYWSREERRNALESVSVEEFAAFRDTLLNGVHLEMLVLGNLTEADAT--------NLAETLQKKlPAIGSTWYRNPSVYL 719
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  772 PDRGWFVY----QQRNEVhNNCgieIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLR 847
Cdd:COG1025   720 LKGGTRIFetvgGESDSA-NAA---ILYPQQYDEIKSSALSSLLGQLIHPWFFDQLRTKEQLGYAVFSGPREVGRTPGIG 795
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  848 FIIQSE-KPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVA 926
Cdd:COG1025   796 FLVQSNsKSPSYLLERINAFLETAEPELREMSEEDFEQIKKALINQILQPPQNLAEEASRLWKAFGRGNLDFDHREKKIE 875
                         890       900       910
                  ....*....|....*....|....*....|..
gi 115495235  927 YLKTLTKEDIIKFYKEmlAVDAPRRHKVSVHV 958
Cdd:COG1025   876 AVKTLTKQKLLDFFEN--ALSYEQGSKLLSHI 905
PRK15101 PRK15101
protease3; Provisional
54-950 2.40e-147

protease3; Provisional


Pssm-ID: 185056  Cd Length: 961  Bit Score: 467.53  E-value: 2.40e-147
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   54 IIKSHEDKREYRGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSE 133
Cdd:PRK15101   34 IRKSEKDPRQYQAIRLDNGMTVLLVSDPQAVKSLAALALPVGSLEDPDAQQGLAHYLEHMVLMGSKKYPQPDSLAEFLKK 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  134 HAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKH 213
Cdd:PRK15101  114 HGGSHNASTASYRTAFYLEVENDALPPAVDRLADAIAEPLLDPKNADRERNAVNAELTMARSRDGMRMAQVSAETINPAH 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  214 PFSKFGTGNKYTLETRPNQEgidVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPF 293
Cdd:PRK15101  194 PGSRFSGGNLETLSDKPGSK---LQDALVDFYQRYYSANLMKAVIYSNQPLPELAKLAADTFGRVPNKNASVPEITVPVV 270
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  294 QEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQK---EGARGF 370
Cdd:PRK15101  271 TDAQKGIIIHYVPAQPRKVLRVEFRIDNNSAKFRSKTDEYISYLIGNRSPGTLSDWLQKQGLAEGISAGADpmvDRNSGV 350
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  371 mfFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVL 450
Cdd:PRK15101  351 --FAISVSLTDKGLAQRDQVVAAIFSYLNLLREKGIDKSYFDELAHVLDLDFRYPSITRDMDYIEWLADTMLRVPVEHTL 428
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  451 TAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKsfEGKTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPMKNEF 530
Cdd:PRK15101  429 DAPYIADRYDPKAIKARLAEMTPQNARIWYISP--QEPHNKTAYFVDAPYQVDKISEQTFADWQQKAQNIALSLPELNPY 506
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  531 IPTNFEILSLEKEATpYPSLIKDT------AMSKLWFKQDdkfflPKACLNFEFFSPFAYVDPLHCNMAYL--YLELLkd 602
Cdd:PRK15101  507 IPDDFSLIKADKAYK-HPELIVDEpglrvvYMPSQYFADE-----PKADISLVLRNPKAMDSARNQVLFALndYLAGL-- 578
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  603 SLNEYAYAAELAGLSYDLqNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHA 682
Cdd:PRK15101  579 ALDQLSNQASVGGISFST-NANNGLMVNANGYTQRLPQLLQALLEGYFSFTPTEEQLAQAKSWYREQLDSAEKGKAYEQA 657
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  683 MYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAAlgimqmveDTLIEHAHTK-PLLPS 761
Cdd:PRK15101  658 IMPAQMLSQVPYFERDERRKLLPSITLKDVLAYRDALLSGATPEFLVVGNLTEEQV--------TTLARDVQKQlGADGT 729
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  762 QLVRYREVQLPDRGWFVYQQRNEVHNNCGIEIYYQT---DMQSTSENMFLElfcQIISEPCFNTLRTKEQLGYIVFSGPR 838
Cdd:PRK15101  730 EWWRGKDVVVDKKQSVNFEKAGSSTDSALAAVYVPTgydEYQSSAYSSLLG---QIIQPWFYNQLRTEEQLGYAVFAFPM 806
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  839 RANGIQGLRFIIQS-EKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYN 917
Cdd:PRK15101  807 SVGRQWGMGFLLQSnDKQPAYLWQRYQAFFPQAEAKLRAMKPEEFAQYQQALINQLLQAPQTLGEEASRLSKDFDRGNMR 886
                         890       900       910
                  ....*....|....*....|....*....|....
gi 115495235  918 FD-RDNIeVAYLKTLTKEDIIKFYKEmlAVDAPR 950
Cdd:PRK15101  887 FDsRDKI-IAQIKLLTPQKLADFFHQ--AVIEPQ 917
Peptidase_M16_M pfam16187
Middle or third domain of peptidase_M16; Peptidase_M16_M is the third domain of peptidase_M16 ...
422-703 2.07e-134

Middle or third domain of peptidase_M16; Peptidase_M16_M is the third domain of peptidase_M16 in eukaryotes of the insulin-degrading-enzyme type. Insulin-degrading enzymes - insulysin - are zinc metallopeptidases that metabolize several bioactive peptides, including insulin and the amyloid-beta-peptide. The tertiary structure of insulin-degrading enzymes resembles a clamshell composed of four structurally similar domains arranged to enclose a large central chamber. Substrates must enter the chamber, and it is likely that a hinge-like conformational change allows substrate binding and product release. Triphosphates are found to dock between the inner surfaces of the non-catalytic domains three and four.


Pssm-ID: 318428  Cd Length: 284  Bit Score: 410.00  E-value: 2.07e-134
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   422 FRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTDRTEEWYGTQYK 501
Cdd:pfam16187    1 FRFKEKSPPSDYVSSLASNMQKYPPEDVLSGDYLLREYDPELIKELLDYLTPENARITLVSKEFEGETDKKEPWYGTEYS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   502 QEAIPDEVIKKWQNADL-NGKFKLPMKNEFIPTNFEILSLE-KEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFF 579
Cdd:pfam16187   81 VEKIPEELLKKWKNPEPsNPELHLPEPNPFIPTDFSLKKPEvEEPAKYPVLIRDTPGSRLWYKKDDTFWVPKAYIYLSLR 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   580 SPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRF 659
Cdd:pfam16187  161 SPLAYSSPKNAVLTRLYVELLKDSLNEYAYDAELAGLSYSLSATERGLTLSVSGYNDKLPVLLEKILEKLKNFEIDEDRF 240
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....
gi 115495235   660 EIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEA 703
Cdd:pfam16187  241 EIIKEQLLRALKNFKLEQPYQQAFYYLLYLLEERSWTPEEKLEA 284
Peptidase_M16 pfam00675
Insulinase (Peptidase family M16);
74-212 1.23e-48

Insulinase (Peptidase family M16);


Pssm-ID: 307015  Cd Length: 149  Bit Score: 171.71  E-value: 1.23e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235    74 KVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPkENEYSQFLSEHAGSSNAFTSGEHTNYYFDV 153
Cdd:pfam00675    1 RVALEHDPPADTSAVGLWVDAGSRYEPDDNNGLAHFLEHMAFKGTKKYP-SNELEEELEKLGGSLNAYTSRENTVYYFEV 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   154 SHEHLEGALDRFAQFFLCPLFDESCKDR-------EVNAVDSEHEK----NVMNDAWRLFQLEKATGNPK 212
Cdd:pfam00675   80 LNDDLPKALDRLADFFRNPLFTESEIERerlvvlyEVEAVDAEPQLvvleNLHAAAYRITPLGRPLLGPG 149
PqqL COG0612
Predicted Zn-dependent peptidase [General function prediction only];
69-483 2.24e-37

Predicted Zn-dependent peptidase [General function prediction only];


Pssm-ID: 223685  Cd Length: 438  Bit Score: 147.61  E-value: 2.24e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   69 LANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPkENEYSQFLSEHAGSSNAFTSGEHTN 148
Cdd:COG0612    22 LPNGLRVITYPNPTAPTVSLDVWVKAGSRAEPAGKAGIAHFLEHMAFKGTTGLP-SAELAEAFEKLGGQLNAFTSFDYTV 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  149 YYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLET 228
Cdd:COG0612   101 YYLSVLPDNLDKALDLLADILLNPTFDEEEVEREKGVILEEIRMRQDDPDDLAFERLLEALYGNHPLGRPILGTEESIEA 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  229 rpnqegIDvRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLKQLYK-IVPI 307
Cdd:COG0612   181 ------IT-REDLKDFYQKWYQPDNMVLVVVGDVDAEEVVELIEKYFGDLPGAAPPPKIPPEPPLGPERVVRVNDpEQPD 253
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  308 KDIRNLYVTFPIPDLQKyYKSNPGHYLGHLIGHEGPGS-LLSELKSK-GW---VNTLVGGQKEGARGFMFFIINVDLTEE 382
Cdd:COG0612   254 LEQAWLALGYPGPDYDS-PDDYAALLLLNGLLGGGFSSrLFQELREKrGLaysVSSFSDFLSDSGLFSIYAGTAPENPEK 332
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235  383 GLLHVEDIILhmfQYIQKLRAEGPQEWVFQecKDLNAVAFRFKDKERPrgytSKIAGILhyypleevltAEYLLEEFRPD 462
Cdd:COG0612   333 TAELVEEILK---ALKKGLKGPFTEEELDA--AKQLLIGLLLLSLDSP----SSIAELL----------GQYLLLGGSLI 393
                         410       420
                  ....*....|....*....|.
gi 115495235  463 LIEMVLDKLrpENVRVAIVSK 483
Cdd:COG0612   394 TLEELLERI--EAVTLEDVNA 412
PQQ_syn_pqqF TIGR02110
coenzyme PQQ biosynthesis probable peptidase PqqF; In a subset of species that make coenzyme ...
65-359 1.12e-33

coenzyme PQQ biosynthesis probable peptidase PqqF; In a subset of species that make coenzyme PQQ (pyrrolo-quinoline-quinone), this probable peptidase is found in the PQQ biosynthesis region and is thought to act as a protease on PqqA (TIGR02107), a probable peptide precursor of the coenzyme. PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]


Pssm-ID: 273978  Cd Length: 697  Bit Score: 138.85  E-value: 1.12e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235    65 RGLELANGIKVLLVSDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSG 144
Cdd:TIGR02110    1 RRITLPNGLRVHLYHQPDAKRAAALLRVAAGSHDEPSAWPGLAHFLEHLLFLGGERFQGDDRLMPWVQRQGGQVNATTLE 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   145 EHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKnVMNDAWRLFQLEKATG-NPKHPFSKFGTGNK 223
Cdd:TIGR02110   81 RTTAFFFELPAAALAAGLARLCDMLARPLLTAEDQQREREVLEAEYIA-WQNDADTLREAALLDAlQAGHPLRRFHAGSR 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   224 YTLETrPNQEgidVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNvPLPEFPEHPFQEEHLKQLYK 303
Cdd:TIGR02110  160 DSLAL-PNTA---FQQALRDFHRRHYQAGNMQLWLQGPQSLDELEQLAARFGASLAAGG-ECAQAPPAPLLRFDRLTLAG 234
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 115495235   304 IVPikdiRNLYVTFPIPDLQKYYKSNPGhYLGHLIGHEGPGSLLSELKSKGWVNTL 359
Cdd:TIGR02110  235 GSE----PRLWLLFALAGLPATARDNVT-LLCEFLQDEAPGGLLAQLRERGLAESV 285
Peptidase_M16_C pfam05193
Peptidase M16 inactive domain; Peptidase M16 consists of two structurally related domains. One ...
238-416 2.44e-28

Peptidase M16 inactive domain; Peptidase M16 consists of two structurally related domains. One is the active peptidase, whereas the other is inactive. The two domains hold the substrate like a clamp.


Pssm-ID: 310063  Cd Length: 181  Bit Score: 114.81  E-value: 2.44e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   238 RQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKnvPLPEFPEHPFQEEHLKQLYKIVPIKDIRN--LYV 315
Cdd:pfam05193    4 REDLRDFYKKYYSPDNMVLVVVGDVDHDELLDLAEKYFGDLPAS--APGKPRPPPLEPAKLTGRRVVVPDKDEPQahLAL 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   316 TFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSK-GWVNTLVGGQkEGARGFMFFIINVDLTEEgllHVEDIILHM 394
Cdd:pfam05193   82 AFPGPPLNNDEDSLALDVLNELLGGGMSSRLFQELREKeGLAYSVSSFN-DSYSDTGLFGIYATLDPE---NVDEVIELI 157
                          170       180
                   ....*....|....*....|..
gi 115495235   395 FQYIQKLRAEGPQEWVFQECKD 416
Cdd:pfam05193  158 LEELEKLAEEGVTEEELERAKN 179
Peptidase_M16_C pfam05193
Peptidase M16 inactive domain; Peptidase M16 consists of two structurally related domains. One ...
706-889 5.95e-14

Peptidase M16 inactive domain; Peptidase M16 consists of two structurally related domains. One is the active peptidase, whereas the other is inactive. The two domains hold the substrate like a clamp.


Pssm-ID: 310063  Cd Length: 181  Bit Score: 72.43  E-value: 5.95e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   706 DVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALgimQMVEDTLiehAHTKPLLPSQLVRYREVQLPDRGWFVYQQRNEV 785
Cdd:pfam05193    1 SLTREDLRDFYKKYYSPDNMVLVVVGDVDHDELL---DLAEKYF---GDLPASAPGKPRPPPLEPAKLTGRRVVVPDKDE 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115495235   786 hNNCGIEIYYQTDMQSTSENMF-LELFCQIISE----PCFNTLRTKEQLGYIVFSGPR--RANGIQGLRFIIQSEKpphy 858
Cdd:pfam05193   75 -PQAHLALAFPGPPLNNDEDSLaLDVLNELLGGgmssRLFQELREKEGLAYSVSSFNDsySDTGLFGIYATLDPEN---- 149
                          170       180       190
                   ....*....|....*....|....*....|..
gi 115495235   859 LESRVEAFLITMEKSIED-MTEEAFQKHIQAL 889
Cdd:pfam05193  150 VDEVIELILEELEKLAEEgVTEEELERAKNQL 181
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH