NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|115430099|ref|NP_000540|]
View 

thyrotropin subunit beta isoform 1 precursor [Homo sapiens]

Protein Classification

GHB_like domain-containing protein (domain architecture ID 11251631)

GHB_like domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GHB smart00068
Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones ...
18-126 2.18e-47

Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.


:

Pssm-ID: 214502  Cd Length: 107  Bit Score: 151.67  E-value: 2.18e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099    18 AMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPkyALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSY 97
Cdd:smart00068   1 LRPGCRPTNATIAVEKEECPVCITINTTICAGYCYTRDPVYKSPLP--PLPQRVCTYRELRYETVRLPGCPPGVDPVVTY 78
                           90       100
                   ....*....|....*....|....*....
gi 115430099    98 PVALSCKCGKCNTDYSDCIHEAIKTNYCT 126
Cdd:smart00068  79 PVALSCHCGKCNTDTTDCTVESLGPDSCS 107
 
Name Accession Description Interval E-value
GHB smart00068
Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones ...
18-126 2.18e-47

Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.


Pssm-ID: 214502  Cd Length: 107  Bit Score: 151.67  E-value: 2.18e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099    18 AMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPkyALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSY 97
Cdd:smart00068   1 LRPGCRPTNATIAVEKEECPVCITINTTICAGYCYTRDPVYKSPLP--PLPQRVCTYRELRYETVRLPGCPPGVDPVVTY 78
                           90       100
                   ....*....|....*....|....*....
gi 115430099    98 PVALSCKCGKCNTDYSDCIHEAIKTNYCT 126
Cdd:smart00068  79 PVALSCHCGKCNTDTTDCTVESLGPDSCS 107
GHB_like cd00069
Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the ...
22-118 9.07e-42

Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the beta chains of gonadotropins, thyrotropins, follitropins, choriogonadotropins and more. The members are reproductive hormones that consist of two glycosylated chains (alpha and beta), which form a tightly bound dimer.


Pssm-ID: 200450  Cd Length: 96  Bit Score: 137.03  E-value: 9.07e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099  22 CIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKyALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVAL 101
Cdd:cd00069    1 CHPRNYTIAVEKEGCGVCLAINTTICAGRCDTRDPVYKSPPYK-PSHQPVCTYDEWRYETVRLPGCPPGVDPTYTYPVAL 79
                         90
                 ....*....|....*..
gi 115430099 102 SCKCGKCNTDYSDCIHE 118
Cdd:cd00069   80 SCRCGLCNTDTTDCTRL 96
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
19-125 2.52e-40

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerisation.


Pssm-ID: 109076  Cd Length: 105  Bit Score: 133.30  E-value: 2.52e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099   19 MSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDinGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYP 98
Cdd:pfam00007   1 RKKCIPTNYTISVEKEGCTSCKTINTTICAGYCYTRD--PVYKDGRRAVSQRVCTYRDVTYETVVLPGCPPGVDPTVTYP 78
                          90       100
                  ....*....|....*....|....*..
gi 115430099   99 VALSCKCGKCNTDYSDCIHEAIKTNYC 125
Cdd:pfam00007  79 VALSCHCGNCPTDNSDCTRLSLQPDSC 105
 
Name Accession Description Interval E-value
GHB smart00068
Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones ...
18-126 2.18e-47

Glycoprotein hormone beta chain homologues; Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.


Pssm-ID: 214502  Cd Length: 107  Bit Score: 151.67  E-value: 2.18e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099    18 AMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPkyALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSY 97
Cdd:smart00068   1 LRPGCRPTNATIAVEKEECPVCITINTTICAGYCYTRDPVYKSPLP--PLPQRVCTYRELRYETVRLPGCPPGVDPVVTY 78
                           90       100
                   ....*....|....*....|....*....
gi 115430099    98 PVALSCKCGKCNTDYSDCIHEAIKTNYCT 126
Cdd:smart00068  79 PVALSCHCGKCNTDTTDCTVESLGPDSCS 107
GHB_like cd00069
Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the ...
22-118 9.07e-42

Glycoprotein hormone beta chain homologues; This family of cystine-knot hormones includes the beta chains of gonadotropins, thyrotropins, follitropins, choriogonadotropins and more. The members are reproductive hormones that consist of two glycosylated chains (alpha and beta), which form a tightly bound dimer.


Pssm-ID: 200450  Cd Length: 96  Bit Score: 137.03  E-value: 9.07e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099  22 CIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKyALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVAL 101
Cdd:cd00069    1 CHPRNYTIAVEKEGCGVCLAINTTICAGRCDTRDPVYKSPPYK-PSHQPVCTYDEWRYETVRLPGCPPGVDPTYTYPVAL 79
                         90
                 ....*....|....*..
gi 115430099 102 SCKCGKCNTDYSDCIHE 118
Cdd:cd00069   80 SCRCGLCNTDTTDCTRL 96
Cys_knot pfam00007
Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of ...
19-125 2.52e-40

Cystine-knot domain; The family comprises glycoprotein hormones and the C-terminal domain of various extracellular proteins. It is believed to be involved in disulfide-linked dimerisation.


Pssm-ID: 109076  Cd Length: 105  Bit Score: 133.30  E-value: 2.52e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115430099   19 MSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDinGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYP 98
Cdd:pfam00007   1 RKKCIPTNYTISVEKEGCTSCKTINTTICAGYCYTRD--PVYKDGRRAVSQRVCTYRDVTYETVVLPGCPPGVDPTVTYP 78
                          90       100
                  ....*....|....*....|....*..
gi 115430099   99 VALSCKCGKCNTDYSDCIHEAIKTNYC 125
Cdd:pfam00007  79 VALSCHCGNCPTDNSDCTRLSLQPDSC 105
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH