NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|11496708|ref|NP_045522|]
View 

antigen P35 (plasmid) [Borrelia burgdorferi B31]

Protein Classification

Borrelia_lipo_1 domain-containing protein (domain architecture ID 10529721)

Borrelia_lipo_1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Borrelia_lipo_1 pfam05714
Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several ...
47-248 1.61e-66

Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several virulent strain associated lipoproteins from the Lyme disease spirochete Borrelia burgdorferi.


:

Pssm-ID: 310373  Cd Length: 200  Bit Score: 208.05  E-value: 1.61e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708    47 KNKLLDDLINLIEKANADREKYVKKMEEEPSDQYGMLAvFGGMYWAESPRELISDTGsERSIRYRRRVYSILlNAIETNE 126
Cdd:pfam05714   1 KNELLNDIKNLIETANEDLEKYEKKLEEEPSDQYGIQA-FKNLDWYTGKEELIDDNT-EESKKYRKRLYASL-NYINEDE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708   127 LKKFSEIR-ILSIKVLEIFSLFNLFGSTLDDVVVHLYSKKDTLGKLDISNLKRLKNLFEKLLSIKTIVSKMSKRLLLDYQ 205
Cdd:pfam05714  78 LKKLGEILnNNLKQPKKIFNTINELGGNFEKIINHLYSKKDTLDKLNIEDLKKLKNSLEKLLSIREIFSKMIKKLLLDYQ 157
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 11496708   206 NNENFIKTDNAKLGSYVVALSNQIQEKYNEAERLKSEIILIYT 248
Cdd:pfam05714 158 NNTNSIQTDNNKLGSYFNTLYKQIKNKIKEAKNLKNTILSIYT 200
 
Name Accession Description Interval E-value
Borrelia_lipo_1 pfam05714
Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several ...
47-248 1.61e-66

Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several virulent strain associated lipoproteins from the Lyme disease spirochete Borrelia burgdorferi.


Pssm-ID: 310373  Cd Length: 200  Bit Score: 208.05  E-value: 1.61e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708    47 KNKLLDDLINLIEKANADREKYVKKMEEEPSDQYGMLAvFGGMYWAESPRELISDTGsERSIRYRRRVYSILlNAIETNE 126
Cdd:pfam05714   1 KNELLNDIKNLIETANEDLEKYEKKLEEEPSDQYGIQA-FKNLDWYTGKEELIDDNT-EESKKYRKRLYASL-NYINEDE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708   127 LKKFSEIR-ILSIKVLEIFSLFNLFGSTLDDVVVHLYSKKDTLGKLDISNLKRLKNLFEKLLSIKTIVSKMSKRLLLDYQ 205
Cdd:pfam05714  78 LKKLGEILnNNLKQPKKIFNTINELGGNFEKIINHLYSKKDTLDKLNIEDLKKLKNSLEKLLSIREIFSKMIKKLLLDYQ 157
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 11496708   206 NNENFIKTDNAKLGSYVVALSNQIQEKYNEAERLKSEIILIYT 248
Cdd:pfam05714 158 NNTNSIQTDNNKLGSYFNTLYKQIKNKIKEAKNLKNTILSIYT 200
 
Name Accession Description Interval E-value
Borrelia_lipo_1 pfam05714
Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several ...
47-248 1.61e-66

Borrelia burgdorferi virulent strain associated lipoprotein; This family consists of several virulent strain associated lipoproteins from the Lyme disease spirochete Borrelia burgdorferi.


Pssm-ID: 310373  Cd Length: 200  Bit Score: 208.05  E-value: 1.61e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708    47 KNKLLDDLINLIEKANADREKYVKKMEEEPSDQYGMLAvFGGMYWAESPRELISDTGsERSIRYRRRVYSILlNAIETNE 126
Cdd:pfam05714   1 KNELLNDIKNLIETANEDLEKYEKKLEEEPSDQYGIQA-FKNLDWYTGKEELIDDNT-EESKKYRKRLYASL-NYINEDE 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11496708   127 LKKFSEIR-ILSIKVLEIFSLFNLFGSTLDDVVVHLYSKKDTLGKLDISNLKRLKNLFEKLLSIKTIVSKMSKRLLLDYQ 205
Cdd:pfam05714  78 LKKLGEILnNNLKQPKKIFNTINELGGNFEKIINHLYSKKDTLDKLNIEDLKKLKNSLEKLLSIREIFSKMIKKLLLDYQ 157
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 11496708   206 NNENFIKTDNAKLGSYVVALSNQIQEKYNEAERLKSEIILIYT 248
Cdd:pfam05714 158 NNTNSIQTDNNKLGSYFNTLYKQIKNKIKEAKNLKNTILSIYT 200
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH