NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|114641097|ref|XP_001147053|]
View 

PREDICTED: etoposide-induced protein 2.4 homolog [Pan troglodytes]

Protein Classification

similar to etoposide-induced protein 2 (domain architecture ID 10537971)

protein similar to etoposide-induced protein 2

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EI24 pfam07264
Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic ...
120-254 2.45e-10

Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.


:

Pssm-ID: 284638  Cd Length: 161  Bit Score: 57.57  E-value: 2.45e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114641097  120 FFLTSIFSALWVLPLFVLskVVNAIWFQDIADlafEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQgMFVSLFPIhlV 199
Cdd:pfam07264  26 LLLLLLLLPLFLFPAVAL--LIAAPFYGLLAE---KVEKRHLTGQEGLLRDLGRSLKKLLLFLLFLLV-LLPLLFPV--V 97
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 114641097  200 GQLVSLLHMSLLYS-LYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTA 254
Cdd:pfam07264  98 GQILAPVLWFWLTArMYAFDYLDYPLERSFEERRALLRRRRALFLGFGLLVALLLL 153
 
Name Accession Description Interval E-value
EI24 pfam07264
Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic ...
120-254 2.45e-10

Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.


Pssm-ID: 284638  Cd Length: 161  Bit Score: 57.57  E-value: 2.45e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114641097  120 FFLTSIFSALWVLPLFVLskVVNAIWFQDIADlafEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQgMFVSLFPIhlV 199
Cdd:pfam07264  26 LLLLLLLLPLFLFPAVAL--LIAAPFYGLLAE---KVEKRHLTGQEGLLRDLGRSLKKLLLFLLFLLV-LLPLLFPV--V 97
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 114641097  200 GQLVSLLHMSLLYS-LYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTA 254
Cdd:pfam07264  98 GQILAPVLWFWLTArMYAFDYLDYPLERSFEERRALLRRRRALFLGFGLLVALLLL 153
 
Name Accession Description Interval E-value
EI24 pfam07264
Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic ...
120-254 2.45e-10

Etoposide-induced protein 2.4 (EI24); This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.


Pssm-ID: 284638  Cd Length: 161  Bit Score: 57.57  E-value: 2.45e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114641097  120 FFLTSIFSALWVLPLFVLskVVNAIWFQDIADlafEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQgMFVSLFPIhlV 199
Cdd:pfam07264  26 LLLLLLLLPLFLFPAVAL--LIAAPFYGLLAE---KVEKRHLTGQEGLLRDLGRSLKKLLLFLLFLLV-LLPLLFPV--V 97
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 114641097  200 GQLVSLLHMSLLYS-LYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTA 254
Cdd:pfam07264  98 GQILAPVLWFWLTArMYAFDYLDYPLERSFEERRALLRRRRALFLGFGLLVALLLL 153
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH