NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|109633031|ref|NP_937983|]
View 

telomerase reverse transcriptase isoform 1 [Homo sapiens]

Protein Classification

Telomerase_RBD and TERT domain-containing protein (domain architecture ID 10659497)

protein containing domains Telomerase_RBD, RT_like, and TERT

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Telomerase_RBD smart00975
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
460-594 6.44e-59

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


:

Pssm-ID: 214948  Cd Length: 136  Bit Score: 200.56  E-value: 6.44e-59
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031    460 QVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVG-CVPAAEHRLRE 538
Cdd:smart00975    1 QVVSFLRAILRKLFPLSLWGSRHNKRVFLKNLRRFLSLGRNEKFSLQELMWGIRVSDIPWLAGSKTTTqRVSKSEHEKRQ 80
                            90       100       110       120       130
                    ....*....|....*....|....*....|....*....|....*....|....*.
gi 109633031    539 EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLK 594
Cdd:smart00975   81 ELLAQFVYWLFDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
825-936 4.19e-40

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


:

Pssm-ID: 238826  Cd Length: 119  Bit Score: 146.64  E-value: 4.19e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  825 YVQCQGIPQGSILSTLLCSLCYGDMENKLFAG---IRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRG-VPEYGCVVNL 900
Cdd:cd01648    14 YRQKVGIPQGSPLSSLLCSLYYADLENKYLSFldvIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTFVNF 93
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 109633031  901 RKTVVNFPvedealggtaFVQMPAHGLFPWCGLLLD 936
Cdd:cd01648    94 DKTQINFS----------FAQLDSSDLIPWCGLLIN 119
RT_like super family cl02808
RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family. An RT gene is ...
618-729 6.45e-03

RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family. An RT gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. RTs occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. These elements can be divided into two major groups. One group contains retroviruses and DNA viruses whose propagation involves an RNA intermediate. They are grouped together with transposable elements containing long terminal repeats (LTRs). The other group, also called poly(A)-type retrotransposons, contain fungal mitochondrial introns and transposable elements that lack LTRs.


The actual alignment was detected with superfamily member cd01650:

Pssm-ID: 295487  Cd Length: 220  Bit Score: 39.20  E-value: 6.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  618 TSRLRFIPKPDGL------RPI--VNMDYVVGARTfrrekraerLTSRVKALFSVLNYE--RARRPGllgASVLglDDIH 687
Cdd:cd01650     1 KARIILIPKKGKPsdpknyRPIslLSVLYKLLEKI---------LANRLRPVLEENILPnqFGFRPG---RSTT--DAIL 66
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 109633031  688 RAWRtfvLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVI 729
Cdd:cd01650    67 LLRE---VIEKAKEKKKSLVLVFLDFEKAFDSVDHEFLLKAL 105
 
Name Accession Description Interval E-value
Telomerase_RBD smart00975
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
460-594 6.44e-59

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 214948  Cd Length: 136  Bit Score: 200.56  E-value: 6.44e-59
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031    460 QVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVG-CVPAAEHRLRE 538
Cdd:smart00975    1 QVVSFLRAILRKLFPLSLWGSRHNKRVFLKNLRRFLSLGRNEKFSLQELMWGIRVSDIPWLAGSKTTTqRVSKSEHEKRQ 80
                            90       100       110       120       130
                    ....*....|....*....|....*....|....*....|....*....|....*.
gi 109633031    539 EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLK 594
Cdd:smart00975   81 ELLAQFVYWLFDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
Telomerase_RBD pfam12009
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
460-586 5.64e-58

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 314825  Cd Length: 128  Bit Score: 197.70  E-value: 5.64e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031   460 QVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGC-VPAAEHRLRE 538
Cdd:pfam12009    1 QVSAFLRAVLRKLIPKELWGSKHNKRVLLKNVKKFLKLRRFESLSLHELMQGLKVSDFPWLGPPGTSNRkLSASDFRKRQ 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 109633031   539 EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQS 586
Cdd:pfam12009   81 ELLAEFLYWLFDSFVIPLIRSFFYVTESSSHRNRLFYFRHDVWRKLSE 128
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
825-936 4.19e-40

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


Pssm-ID: 238826  Cd Length: 119  Bit Score: 146.64  E-value: 4.19e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  825 YVQCQGIPQGSILSTLLCSLCYGDMENKLFAG---IRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRG-VPEYGCVVNL 900
Cdd:cd01648    14 YRQKVGIPQGSPLSSLLCSLYYADLENKYLSFldvIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTFVNF 93
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 109633031  901 RKTVVNFPvedealggtaFVQMPAHGLFPWCGLLLD 936
Cdd:cd01648    94 DKTQINFS----------FAQLDSSDLIPWCGLLIN 119
RVT_1 pfam00078
Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually ...
798-905 4.41e-07

Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses.


Pssm-ID: 306564  Cd Length: 189  Bit Score: 51.15  E-value: 4.41e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031   798 LNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCygdMeNKLFAGIR-RDGL-LLRLVDDFLLVTP 875
Cdd:pfam00078   70 LDELDRKLTAFTTPPININWNGELSGGRYEWKGLPQGLVLSPALFQLF---M-NELLRPLRkRAGLtLVRYADDILIFSK 145
                           90       100       110
                   ....*....|....*....|....*....|
gi 109633031   876 HLTHAKTFLRTLVRGVPEYGCVVNLRKTVV 905
Cdd:pfam00078  146 SEEEHQEALEEVLEWLKESGLKINPEKTQF 175
RT_nLTR_like cd01650
RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse ...
618-729 6.45e-03

RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT). This subfamily contains both non-LTR retrotransposons and non-LTR retrovirus RTs. RTs catalyze the conversion of single-stranded RNA into double-stranded DNA for integration into host chromosomes. RT is a multifunctional enzyme with RNA-directed DNA polymerase, DNA directed DNA polymerase and ribonuclease hybrid (RNase H) activities.


Pssm-ID: 238827  Cd Length: 220  Bit Score: 39.20  E-value: 6.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  618 TSRLRFIPKPDGL------RPI--VNMDYVVGARTfrrekraerLTSRVKALFSVLNYE--RARRPGllgASVLglDDIH 687
Cdd:cd01650     1 KARIILIPKKGKPsdpknyRPIslLSVLYKLLEKI---------LANRLRPVLEENILPnqFGFRPG---RSTT--DAIL 66
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 109633031  688 RAWRtfvLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVI 729
Cdd:cd01650    67 LLRE---VIEKAKEKKKSLVLVFLDFEKAFDSVDHEFLLKAL 105
 
Name Accession Description Interval E-value
Telomerase_RBD smart00975
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
460-594 6.44e-59

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 214948  Cd Length: 136  Bit Score: 200.56  E-value: 6.44e-59
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031    460 QVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVG-CVPAAEHRLRE 538
Cdd:smart00975    1 QVVSFLRAILRKLFPLSLWGSRHNKRVFLKNLRRFLSLGRNEKFSLQELMWGIRVSDIPWLAGSKTTTqRVSKSEHEKRQ 80
                            90       100       110       120       130
                    ....*....|....*....|....*....|....*....|....*....|....*.
gi 109633031    539 EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLK 594
Cdd:smart00975   81 ELLAQFVYWLFDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
Telomerase_RBD pfam12009
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
460-586 5.64e-58

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 314825  Cd Length: 128  Bit Score: 197.70  E-value: 5.64e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031   460 QVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGC-VPAAEHRLRE 538
Cdd:pfam12009    1 QVSAFLRAVLRKLIPKELWGSKHNKRVLLKNVKKFLKLRRFESLSLHELMQGLKVSDFPWLGPPGTSNRkLSASDFRKRQ 80
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 109633031   539 EILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQS 586
Cdd:pfam12009   81 ELLAEFLYWLFDSFVIPLIRSFFYVTESSSHRNRLFYFRHDVWRKLSE 128
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
825-936 4.19e-40

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


Pssm-ID: 238826  Cd Length: 119  Bit Score: 146.64  E-value: 4.19e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  825 YVQCQGIPQGSILSTLLCSLCYGDMENKLFAG---IRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRG-VPEYGCVVNL 900
Cdd:cd01648    14 YRQKVGIPQGSPLSSLLCSLYYADLENKYLSFldvIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTFVNF 93
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 109633031  901 RKTVVNFPvedealggtaFVQMPAHGLFPWCGLLLD 936
Cdd:cd01648    94 DKTQINFS----------FAQLDSSDLIPWCGLLIN 119
RVT_1 pfam00078
Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually ...
798-905 4.41e-07

Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses.


Pssm-ID: 306564  Cd Length: 189  Bit Score: 51.15  E-value: 4.41e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031   798 LNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCygdMeNKLFAGIR-RDGL-LLRLVDDFLLVTP 875
Cdd:pfam00078   70 LDELDRKLTAFTTPPININWNGELSGGRYEWKGLPQGLVLSPALFQLF---M-NELLRPLRkRAGLtLVRYADDILIFSK 145
                           90       100       110
                   ....*....|....*....|....*....|
gi 109633031   876 HLTHAKTFLRTLVRGVPEYGCVVNLRKTVV 905
Cdd:pfam00078  146 SEEEHQEALEEVLEWLKESGLKINPEKTQF 175
RT_G2_intron cd01651
RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin. RT transcribes DNA ...
830-910 1.54e-03

RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin. RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs).


Pssm-ID: 238828  Cd Length: 226  Bit Score: 41.42  E-value: 1.54e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  830 GIPQGSILSTLLCSLCYGDMENKLFAGIR----------RDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVN 899
Cdd:cd01651   126 GTPQGGVISPLLANIYLHELDKFVEEKLKeyydtsdpkfRRLRYVRYADDFVIGVRGPKEAEEIKELIREFLEELGLELN 205
                          90
                  ....*....|..
gi 109633031  900 LRKT-VVNFPVE 910
Cdd:cd01651   206 PEKTrITHFKSE 217
RT_Bac_retron_I cd01646
RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The ...
830-908 1.60e-03

RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The polymerase reaction of this enzyme leads to the production of a unique RNA-DNA complex called msDNA (multicopy single-stranded (ss)DNA) in which a small ssDNA branches out from a small ssRNA molecule via a 2'-5'phosphodiester linkage. Bacterial retron RTs produce cDNA corresponding to only a small portion of the retron genome.


Pssm-ID: 238824  Cd Length: 158  Bit Score: 40.01  E-value: 1.60e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  830 GIPQGSILSTLLC--SLCYGD--MENKLfagirRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKT-V 904
Cdd:cd01646    53 GLPIGPLTSRFLAniYLNDVDheLKSKL-----KGVDYVRYVDDIRIFADSKEEAEEILEELKEFLAELGLSLNLSKTeI 127

                  ....
gi 109633031  905 VNFP 908
Cdd:cd01646   128 LPLP 131
RT_nLTR_like cd01650
RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse ...
618-729 6.45e-03

RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT). This subfamily contains both non-LTR retrotransposons and non-LTR retrovirus RTs. RTs catalyze the conversion of single-stranded RNA into double-stranded DNA for integration into host chromosomes. RT is a multifunctional enzyme with RNA-directed DNA polymerase, DNA directed DNA polymerase and ribonuclease hybrid (RNase H) activities.


Pssm-ID: 238827  Cd Length: 220  Bit Score: 39.20  E-value: 6.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109633031  618 TSRLRFIPKPDGL------RPI--VNMDYVVGARTfrrekraerLTSRVKALFSVLNYE--RARRPGllgASVLglDDIH 687
Cdd:cd01650     1 KARIILIPKKGKPsdpknyRPIslLSVLYKLLEKI---------LANRLRPVLEENILPnqFGFRPG---RSTT--DAIL 66
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 109633031  688 RAWRtfvLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVI 729
Cdd:cd01650    67 LLRE---VIEKAKEKKKSLVLVFLDFEKAFDSVDHEFLLKAL 105
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH