NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|109126610|ref|XP_001100671|]
View 

PREDICTED: cartilage intermediate layer protein 2 [Macaca mulatta]

Protein Classification

Mucin2_WxxW and TSP1 domain-containing protein (domain architecture ID 11209429)

protein containing domains Mucin2_WxxW, TSP1, CarboxypepD_reg, and Ig

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Mucin2_WxxW pfam13330
Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. ...
58-143 1.63e-28

Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. The function is not known, but the repeat can be present in up to 32 copies, as in an uncharacterized protein from Branchiostoma floridae. The region carries a highly conserved WxxW sequence motif and also has at least six well conserved cysteine residues.


:

Pssm-ID: 315900  Cd Length: 85  Bit Score: 112.37  E-value: 1.63e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    58 EWTSWFNVDHPG---GDGDFESLAAIRFYygPARVCPRPLALEARTTDWAlpSTVGERVHLNPTRGFWCLNREQPRGRRC 134
Cdd:pfam13330    1 GWTEWFDVDYPGsgpGGGDFETLENLRAA--GYQICPNPTDIECRAVDPL--EETGQVVTCDLSTGLVCRNADQTDGPQC 76

                   ....*....
gi 109126610   135 SNYHVRFRC 143
Cdd:pfam13330   77 YDYEVRFLC 85
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
291-363 1.62e-12

Immunoglobulin domain; This family contains immunoglobulin-like domains.


:

Pssm-ID: 316449  Cd Length: 76  Bit Score: 65.98  E-value: 1.62e-12
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 109126610   291 RPYLVKHPESRVREAGQNVTFCCKASGTPMPkKYSWFHNGTLLDRRAHR----YGAHLELQGLHPDQAGIYHCKAWN 363
Cdd:pfam13927    1 KPVITVSPSSVVVLEGESVTLTCEATGGPPP-TITWYKNGKPGPTSSRIslsgSNSTLTISNVTREDSGTYTCVASN 76
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
149-197 1.88e-11

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 62.60  E-value: 1.88e-11
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|...
gi 109126610    149 WGAWGPWGPCSGSCGPSRRLRRRHCPSPA----GDACPGRPLEAQRCVRPRCP 197
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPPpqngGGPCTGEDVETRACNEQPCP 53
CarboxypepD_reg pfam13620
Carboxypeptidase regulatory-like domain;
213-286 7.45e-07

Carboxypeptidase regulatory-like domain;


:

Pssm-ID: 316170  Cd Length: 81  Bit Score: 49.59  E-value: 7.45e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 109126610   213 GSVVTRSGQPLPGARISLRDQPGTV---ATSDAHGTFRVLGVCADSHaNIRAQMDGFSAGEAQAQ--ANGSISVVTIIL 286
Cdd:pfam13620    4 GTVTDPSGAPVPGATVTLTNTDTGTvrtTTTDADGRFRFPGLPPGTY-TVTVSAPGFASATRTGVtvTAGQTTTLDVTL 81
 
Name Accession Description Interval E-value
Mucin2_WxxW pfam13330
Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. ...
58-143 1.63e-28

Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. The function is not known, but the repeat can be present in up to 32 copies, as in an uncharacterized protein from Branchiostoma floridae. The region carries a highly conserved WxxW sequence motif and also has at least six well conserved cysteine residues.


Pssm-ID: 315900  Cd Length: 85  Bit Score: 112.37  E-value: 1.63e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    58 EWTSWFNVDHPG---GDGDFESLAAIRFYygPARVCPRPLALEARTTDWAlpSTVGERVHLNPTRGFWCLNREQPRGRRC 134
Cdd:pfam13330    1 GWTEWFDVDYPGsgpGGGDFETLENLRAA--GYQICPNPTDIECRAVDPL--EETGQVVTCDLSTGLVCRNADQTDGPQC 76

                   ....*....
gi 109126610   135 SNYHVRFRC 143
Cdd:pfam13330   77 YDYEVRFLC 85
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
291-363 1.62e-12

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 316449  Cd Length: 76  Bit Score: 65.98  E-value: 1.62e-12
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 109126610   291 RPYLVKHPESRVREAGQNVTFCCKASGTPMPkKYSWFHNGTLLDRRAHR----YGAHLELQGLHPDQAGIYHCKAWN 363
Cdd:pfam13927    1 KPVITVSPSSVVVLEGESVTLTCEATGGPPP-TITWYKNGKPGPTSSRIslsgSNSTLTISNVTREDSGTYTCVASN 76
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
149-197 1.88e-11

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 62.60  E-value: 1.88e-11
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|...
gi 109126610    149 WGAWGPWGPCSGSCGPSRRLRRRHCPSPA----GDACPGRPLEAQRCVRPRCP 197
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPPpqngGGPCTGEDVETRACNEQPCP 53
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
298-377 1.74e-10

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 60.21  E-value: 1.74e-10
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    298 PESRVREAGQNVTFCCKASGTPMPKkYSWFHNGTLLDRRAHRY-------GAHLELQGLHPDQAGIYHCKAWNEAGaVRS 370
Cdd:smart00410    1 PPSVTVKEGESVTLSCEASGSPPPE-VTWYKQGGKLLAESGRFsvsrsgsTSTLTISNVTPEDSGTYTCAATNSSG-SAS 78

                    ....*..
gi 109126610    371 GTAWLTV 377
Cdd:smart00410   79 SGTTLTV 85
Ig cd00096
Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
309-370 7.89e-09

Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319273  Cd Length: 70  Bit Score: 55.33  E-value: 7.89e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109126610  309 VTFCCKASGTPMPKkYSWFHNGTLL------DRRAHRYGAHLELQGLHPDQAGIYHCKAWNEAGAVRS 370
Cdd:cd00096     1 VTLTCSASGNPPPT-ITWLKNGKPLpsssrfRRRSSGGNGTLTISNVTPEDSGTYTCVASNSAGSASA 67
TSP_1 pfam00090
Thrombospondin type 1 domain;
150-196 3.39e-07

Thrombospondin type 1 domain;


Pssm-ID: 306574  Cd Length: 49  Bit Score: 50.13  E-value: 3.39e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 109126610   150 GAWGPWGPCSGSCGPSRRLRRRHCPSPA--GDACPGRPLEAQRCVRPRC 196
Cdd:pfam00090    1 SPWSPWSPCSVTCGKGIRVRQRTCKSPFpgGEPCTGDAIETEACKMDKC 49
CarboxypepD_reg pfam13620
Carboxypeptidase regulatory-like domain;
213-286 7.45e-07

Carboxypeptidase regulatory-like domain;


Pssm-ID: 316170  Cd Length: 81  Bit Score: 49.59  E-value: 7.45e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 109126610   213 GSVVTRSGQPLPGARISLRDQPGTV---ATSDAHGTFRVLGVCADSHaNIRAQMDGFSAGEAQAQ--ANGSISVVTIIL 286
Cdd:pfam13620    4 GTVTDPSGAPVPGATVTLTNTDTGTvrtTTTDADGRFRFPGLPPGTY-TVTVSAPGFASATRTGVtvTAGQTTTLDVTL 81
 
Name Accession Description Interval E-value
Mucin2_WxxW pfam13330
Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. ...
58-143 1.63e-28

Mucin-2 protein WxxW repeating region; This family is repeating region found on mucins 2 and 5. The function is not known, but the repeat can be present in up to 32 copies, as in an uncharacterized protein from Branchiostoma floridae. The region carries a highly conserved WxxW sequence motif and also has at least six well conserved cysteine residues.


Pssm-ID: 315900  Cd Length: 85  Bit Score: 112.37  E-value: 1.63e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    58 EWTSWFNVDHPG---GDGDFESLAAIRFYygPARVCPRPLALEARTTDWAlpSTVGERVHLNPTRGFWCLNREQPRGRRC 134
Cdd:pfam13330    1 GWTEWFDVDYPGsgpGGGDFETLENLRAA--GYQICPNPTDIECRAVDPL--EETGQVVTCDLSTGLVCRNADQTDGPQC 76

                   ....*....
gi 109126610   135 SNYHVRFRC 143
Cdd:pfam13330   77 YDYEVRFLC 85
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
291-363 1.62e-12

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 316449  Cd Length: 76  Bit Score: 65.98  E-value: 1.62e-12
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 109126610   291 RPYLVKHPESRVREAGQNVTFCCKASGTPMPkKYSWFHNGTLLDRRAHR----YGAHLELQGLHPDQAGIYHCKAWN 363
Cdd:pfam13927    1 KPVITVSPSSVVVLEGESVTLTCEATGGPPP-TITWYKNGKPGPTSSRIslsgSNSTLTISNVTREDSGTYTCVASN 76
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
149-197 1.88e-11

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 62.60  E-value: 1.88e-11
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|...
gi 109126610    149 WGAWGPWGPCSGSCGPSRRLRRRHCPSPA----GDACPGRPLEAQRCVRPRCP 197
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPPpqngGGPCTGEDVETRACNEQPCP 53
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
298-377 1.74e-10

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 60.21  E-value: 1.74e-10
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    298 PESRVREAGQNVTFCCKASGTPMPKkYSWFHNGTLLDRRAHRY-------GAHLELQGLHPDQAGIYHCKAWNEAGaVRS 370
Cdd:smart00410    1 PPSVTVKEGESVTLSCEASGSPPPE-VTWYKQGGKLLAESGRFsvsrsgsTSTLTISNVTPEDSGTYTCAATNSSG-SAS 78

                    ....*..
gi 109126610    371 GTAWLTV 377
Cdd:smart00410   79 SGTTLTV 85
IG smart00409
Immunoglobulin;
298-377 1.74e-10

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 60.21  E-value: 1.74e-10
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    298 PESRVREAGQNVTFCCKASGTPMPKkYSWFHNGTLLDRRAHRY-------GAHLELQGLHPDQAGIYHCKAWNEAGaVRS 370
Cdd:smart00409    1 PPSVTVKEGESVTLSCEASGSPPPE-VTWYKQGGKLLAESGRFsvsrsgsTSTLTISNVTPEDSGTYTCAATNSSG-SAS 78

                    ....*..
gi 109126610    371 GTAWLTV 377
Cdd:smart00409   79 SGTTLTV 85
IGc2 smart00408
Immunoglobulin C-2 Type;
306-366 3.74e-10

Immunoglobulin C-2 Type;


Pssm-ID: 197706  Cd Length: 63  Bit Score: 58.96  E-value: 3.74e-10
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 109126610    306 GQNVTFCCKASGTPMPKkYSWFHNGTLLD--RRAHRYGAHLELQGLHPDQAGIYHCKAWNEAG 366
Cdd:smart00408    2 GQSVTLTCPAEGNPVPN-ITWLKDGKPLPesNRFVASGSTLTIKSVSLEDSGLYTCVAENSAG 63
I-set pfam07679
Immunoglobulin I-set domain;
292-377 4.97e-10

Immunoglobulin I-set domain;


Pssm-ID: 254352  Cd Length: 90  Bit Score: 59.19  E-value: 4.97e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610   292 PYLVKHPESRVREAGQNVTFCCKASGTPMPKkYSWFHNGTLLdRRAHRY-------GAHLELQGLHPDQAGIYHCKAWNE 364
Cdd:pfam07679    1 PKFTQKPKDVEVQEGESARFTCTVTGTPDPE-VSWFKDGQPL-RSSDRFkvtyeggTYTLTISNVQPDDSGKYTCVATNS 78
                           90
                   ....*....|...
gi 109126610   365 AGAVRSgTAWLTV 377
Cdd:pfam07679   79 AGEAEA-SAELTV 90
Ig cd00096
Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig ...
309-370 7.89e-09

Immunoglobulin domain; Immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319273  Cd Length: 70  Bit Score: 55.33  E-value: 7.89e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109126610  309 VTFCCKASGTPMPKkYSWFHNGTLL------DRRAHRYGAHLELQGLHPDQAGIYHCKAWNEAGAVRS 370
Cdd:cd00096     1 VTLTCSASGNPPPT-ITWLKNGKPLpsssrfRRRSSGGNGTLTISNVTPEDSGTYTCVASNSAGSASA 67
TSP_1 pfam00090
Thrombospondin type 1 domain;
150-196 3.39e-07

Thrombospondin type 1 domain;


Pssm-ID: 306574  Cd Length: 49  Bit Score: 50.13  E-value: 3.39e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 109126610   150 GAWGPWGPCSGSCGPSRRLRRRHCPSPA--GDACPGRPLEAQRCVRPRC 196
Cdd:pfam00090    1 SPWSPWSPCSVTCGKGIRVRQRTCKSPFpgGEPCTGDAIETEACKMDKC 49
CarboxypepD_reg pfam13620
Carboxypeptidase regulatory-like domain;
213-286 7.45e-07

Carboxypeptidase regulatory-like domain;


Pssm-ID: 316170  Cd Length: 81  Bit Score: 49.59  E-value: 7.45e-07
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 109126610   213 GSVVTRSGQPLPGARISLRDQPGTV---ATSDAHGTFRVLGVCADSHaNIRAQMDGFSAGEAQAQ--ANGSISVVTIIL 286
Cdd:pfam13620    4 GTVTDPSGAPVPGATVTLTNTDTGTvrtTTTDADGRFRFPGLPPGTY-TVTVSAPGFASATRTGVtvTAGQTTTLDVTL 81
Ig1_Robo cd07693
First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; ...
292-377 2.65e-06

First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins; Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143317  Cd Length: 100  Bit Score: 48.31  E-value: 2.65e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  292 PYLVKHPESRVREAGQNVTFCCKASGTPMPkKYSWFHNGTLL-----DRRAHRY----GAHLELQGLHPDQ----AGIYH 358
Cdd:cd07693     2 PRIVEHPSDLIVSKGDPATLNCKAEGRPTP-TIQWLKNGQPLetdkdDPRSHRIvlpsGSLFFLRVVHGRKgrsdEGVYV 80
                          90
                  ....*....|....*....
gi 109126610  359 CKAWNEAGAVRSGTAWLTV 377
Cdd:cd07693    81 CVAHNSLGEAVSRNASLEV 99
Ig_2 pfam13895
Immunoglobulin domain; This domain contains immunoglobulin-like domains.
298-377 6.20e-06

Immunoglobulin domain; This domain contains immunoglobulin-like domains.


Pssm-ID: 316418  Cd Length: 78  Bit Score: 46.59  E-value: 6.20e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610   298 PESRVREaGQNVTFCCKASGTPmPKKYSWFHNGTLL-DRRAHRYGAHlelqglhPDQAGIYHCKAWNEAGAVRSGTAWLT 376
Cdd:pfam13895    7 SPTVVTE-GEPVTLTCSAPGNP-PANYTWYKGGEALnSSPNFISSVS-------AEDSGTYTCVARNGRGGKVSNPVELT 77

                   .
gi 109126610   377 V 377
Cdd:pfam13895   78 V 78
Ig4_Contactin-2-like cd05728
Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; ...
306-377 1.51e-04

Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins; Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.


Pssm-ID: 143205  Cd Length: 85  Bit Score: 42.59  E-value: 1.51e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 109126610  306 GQNVTFCCKASGTPMPkKYSWFHNGTLL--DRRAHRYGAHLELQGLHPDQAGIYHCKAWNEAGAVRSgTAWLTV 377
Cdd:cd05728    14 GSSLRWECKASGNPRP-AYRWLKNGQPLasENRIEVEAGDLRITKLSLSDSGMYQCVAENKHGTIYA-SAELAV 85
Ig2_FGFR cd05857
Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor; Ig2_FGFR: ...
305-369 3.72e-04

Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor; Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.


Pssm-ID: 143265  Cd Length: 85  Bit Score: 41.38  E-value: 3.72e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 109126610  305 AGQNVTFCCKASGTPMPkKYSWFHNGTLLdRRAHRYGAH--------LELQGLHPDQAGIYHCKAWNEAGAVR 369
Cdd:cd05857     8 AANTVKFRCPAAGNPTP-TMRWLKNGKEF-KQEHRIGGYkvrnqhwsLIMESVVPSDKGNYTCVVENEYGSIN 78
Ig1_Contactin-1 cd05849
First immunoglobulin (Ig) domain of contactin-1; Ig1_Contactin-1: First Ig domain of the ...
290-376 7.12e-04

First immunoglobulin (Ig) domain of contactin-1; Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 143257  Cd Length: 93  Bit Score: 40.71  E-value: 7.12e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  290 ERPYLVKHPESRVReaGQnVTFCCKASGTPMPKkYSWFHNGTLLDRRAHRY---GAHLELQglHPDQ---AGIYHCKAWN 363
Cdd:cd05849     6 EQPIDTIYPEESTE--GK-VSVNCRARANPFPI-YKWRKNNLDIDLTNDRYsmvGGNLVIN--NPDKykdAGRYVCIVSN 79
                          90
                  ....*....|...
gi 109126610  364 EAGAVRSGTAWLT 376
Cdd:cd05849    80 IYGKVRSREATLS 92
VOMI pfam03762
Vitelline membrane outer layer protein I (VOMI); VOMI binds tightly to ovomucin fibrils of the ...
47-162 1.98e-03

Vitelline membrane outer layer protein I (VOMI); VOMI binds tightly to ovomucin fibrils of the egg yolk membrane. The structure that consists of three beta-sheets forming Greek key motifs, which are related by an internal pseudo three-fold symmetry. Furthermore, the structure of VOMI has strong similarity to the structure of the delta-endotoxin, as well as a carbohydrate-binding site in the top region of the common fold.


Pssm-ID: 309039  Cd Length: 166  Bit Score: 39.96  E-value: 1.98e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610    47 SPALEDWeeaSEWTSW-----------FN--VDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWalpstvGE-- 111
Cdd:pfam03762    3 VPNGGNW---GDWGWWemcpdgsfaygFSlkVEAPQGGGDDTALNGIRLFCKPLGSTNFSNTIESGEGSW------GDws 73
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 109126610   112 RVHLNPTRGF---WCLNREQPRGRRCS----NyhVRFRCP----LEASWGAWGPWGPCSGSC 162
Cdd:pfam03762   74 GIQWCPSGGYltgFQLRVEPPQGGGDDtaanN--IRFRCSrgreLEGPGDTWGDWGEWSDTC 133
Ig2_FGFRL1-like cd05856
Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1 ...
303-368 2.15e-03

Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1); Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2. FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.


Pssm-ID: 143264  Cd Length: 82  Bit Score: 39.05  E-value: 2.15e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  303 REAGQNVTFCCKASGTPMPKkYSWFHNGTLLD----RRAHRYGAHLELQGLHPDQAGIYHCKAWNEAGAV 368
Cdd:cd05856     6 RPVGSSVRLKCVASGNPRPD-ITWLKDNKPLTpteiGESRKKKWTLSLKNLKPEDSGKYTCHVSNRAGEI 74
Ig1_Contactin cd04967
First immunoglobulin (Ig) domain of contactin; Ig1_Contactin: First Ig domain of contactins. ...
290-373 3.43e-03

First immunoglobulin (Ig) domain of contactin; Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnatal, and a lack of contactin-5 (NB-2) results in an impairment of neuronal activity in the rat auditory system. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.


Pssm-ID: 319276  Cd Length: 91  Bit Score: 38.35  E-value: 3.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  290 ERPYLVKHPESRVREagqNVTFCCKASGTPMPKkYSWFHNGT-LLDRRAHRY---GAHLELQglHPDQ---AGIYHCKAW 362
Cdd:cd04967     6 EQPDDTIFPEESDEE---KVALNCRARANPPPT-YRWKMNGTeIKLEPDSRYslvGGNLVIS--NPSKakdAGHYQCLAT 79
                          90
                  ....*....|.
gi 109126610  363 NEAGAVRSGTA 373
Cdd:cd04967    80 NTVGTVVSREA 90
Ig2_Axl_Tyro3_like cd05749
Second immunoglobulin (Ig)-like domain of Axl/Tyro3 family receptor tyrosine kinases (RTKs); ...
296-373 3.78e-03

Second immunoglobulin (Ig)-like domain of Axl/Tyro3 family receptor tyrosine kinases (RTKs); Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and cell proliferation.


Pssm-ID: 143226  Cd Length: 81  Bit Score: 38.22  E-value: 3.78e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109126610  296 KHPESRVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRAHRYGAHLELQGLHpdQAGIYHCKAWNEAGAVRSGTA 373
Cdd:cd05749     3 VEPEDLSVTANTPFNLTCQAVGPPEPVEILWWQGGSPLGDPPAPSPSVLNVPGLN--ETSKFSCEAHNAKGVTTSRTG 78
Ig2_PTK7 cd05760
Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4; ...
309-370 4.40e-03

Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4; Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in several cancers, including melanoma and colon cancer lines.


Pssm-ID: 143237  Cd Length: 77  Bit Score: 37.97  E-value: 4.40e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 109126610  309 VTFCCKASGTPMPKkYSWFHNGTLL--DRRAHRYGA---HLELQGLHPDQAGIYHCKAWNEAGAVRS 370
Cdd:cd05760     1 VTLRCHIDGHPRPT-YQWFRDGTPLsdGQGNYSVSSkerTLTLRSAGPDDSGLYYCCAHNAFGSVCS 66
Ig_Perlecan_like cd05754
Igmmunoglobulin (Ig)-like domain found in Perlecan and similar proteins; Ig_Perlecan_like: ...
295-375 4.60e-03

Igmmunoglobulin (Ig)-like domain found in Perlecan and similar proteins; Ig_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis. Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites. Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.


Pssm-ID: 143231  Cd Length: 85  Bit Score: 37.91  E-value: 4.60e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  295 VKHPES-RVREaGQNVTFCCKA-SGTPMPKkYSWFHNGTLLDRRAHRYGAHLELQGLHPDQAGIYHCKAWNEaGAVRSGT 372
Cdd:cd05754     5 VEEPRSqEVRP-GADVSFICRAkSKSPAYT-LVWTRVGGGLPSRAMDFNGILTIRNVQLSDAGTYVCTGSNM-LDTDEAT 81

                  ...
gi 109126610  373 AWL 375
Cdd:cd05754    82 ATL 84
Ig2_Robo cd05724
Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig2_Robo: domain ...
312-377 4.95e-03

Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors; Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site.


Pssm-ID: 143201  Cd Length: 86  Bit Score: 37.76  E-value: 4.95e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109126610  312 CCKASGTPMPKkYSWFHNGTLLD----RRAHRYGAHLELQGLHPDQAGIYHCKAWNEAGAVRSGTAWLTV 377
Cdd:cd05724    18 CSPPRGHPEPT-VSWRKDGQPLNldneRVRIVDDGNLLIAEARKSDEGTYKCVATNMVGERESAAARLSV 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH