NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|109086985|ref|XP_001090825|]
View 

PREDICTED: growth/differentiation factor 6 [Macaca mulatta]

Protein Classification

TGFb_propeptide and TGF_beta domain-containing protein (domain architecture ID 10464578)

TGFb_propeptide and TGF_beta domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TGF_beta pfam00019
Transforming growth factor beta like domain;
354-454 9.24e-59

Transforming growth factor beta like domain;


:

Pssm-ID: 306518  Cd Length: 101  Bit Score: 190.98  E-value: 9.24e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  354 CSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYI 433
Cdd:pfam00019   1 CCRRSLYVDFRDLGWDDWIIAPKGYNANYCSGSCPFPLSSHLNPTNHAILQSLVHSLKPRAVPKPCCVPTKLSPLSVLYY 80
                          90       100
                  ....*....|....*....|.
gi 109086985  434 DAGNNVVYKQYEDMVVESCGC 454
Cdd:pfam00019  81 DDEGNVVLKTYPDMVVEECGC 101
TGFb_propeptide pfam00688
TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. ...
78-281 8.85e-31

TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. LAP is a homodimer which is disulfide linked to TGF-beta binding protein.


:

Pssm-ID: 307025  Cd Length: 239  Bit Score: 119.68  E-value: 8.85e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985   78 QQPRAQEPpgRGPRVVPhEYMLSIYRTYSIAEKLGINASFFQSS-----------KSANTITSFVDRGLDDLSHTPLRR- 145
Cdd:pfam00688  33 DRPRPSHP--SLPKSAP-QFMLDLYNSISEEEEEEEGRGRYASPplltvqderaiDEADTVMSFVNKVEHDVPGSRHERh 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  146 -QKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPpaGPLHVQLFPCL--------SPLLLDARTLDpqgAPPAGWEVFD 216
Cdd:pfam00688 110 rKRFWFNLSEIPEGELVTSAELRLYRDKVKERTSN--ETFRISVYQVLkehagrdaSLRLLDSRLVT---ASEEGWLSFD 184
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109086985  217 VWQGLRH---QPWKQLCLELRAAWGEPDAREaethargpqqpppPDLRSLGFGRRVRPPQERALLVVF 281
Cdd:pfam00688 185 VTEALNRwlaNPEENLGLQLSVHTSDRPGRE-------------VRPSRSGLVGRRGWPQKQPFLVTF 239
 
Name Accession Description Interval E-value
TGF_beta pfam00019
Transforming growth factor beta like domain;
354-454 9.24e-59

Transforming growth factor beta like domain;


Pssm-ID: 306518  Cd Length: 101  Bit Score: 190.98  E-value: 9.24e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  354 CSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYI 433
Cdd:pfam00019   1 CCRRSLYVDFRDLGWDDWIIAPKGYNANYCSGSCPFPLSSHLNPTNHAILQSLVHSLKPRAVPKPCCVPTKLSPLSVLYY 80
                          90       100
                  ....*....|....*....|.
gi 109086985  434 DAGNNVVYKQYEDMVVESCGC 454
Cdd:pfam00019  81 DDEGNVVLKTYPDMVVEECGC 101
TGFB smart00204
Transforming growth factor-beta (TGF-beta) family; Family members are active as ...
354-455 3.09e-56

Transforming growth factor-beta (TGF-beta) family; Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types.


Pssm-ID: 214556  Cd Length: 102  Bit Score: 184.40  E-value: 3.09e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985   354 CSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYI 433
Cdd:smart00204   1 CRRRQLYVDFKDLGWDDWIIAPKGYNAYYCEGECPFPLSTSLNATNHAIVQTLVHLLGPNPVPKPCCVPTKLSPLSMLYY 80
                           90       100
                   ....*....|....*....|..
gi 109086985   434 DAGNNVVYKQYEDMVVESCGCR 455
Cdd:smart00204  81 DDDGNVVLRNYPNMVVEECGCR 102
TGFb_propeptide pfam00688
TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. ...
78-281 8.85e-31

TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. LAP is a homodimer which is disulfide linked to TGF-beta binding protein.


Pssm-ID: 307025  Cd Length: 239  Bit Score: 119.68  E-value: 8.85e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985   78 QQPRAQEPpgRGPRVVPhEYMLSIYRTYSIAEKLGINASFFQSS-----------KSANTITSFVDRGLDDLSHTPLRR- 145
Cdd:pfam00688  33 DRPRPSHP--SLPKSAP-QFMLDLYNSISEEEEEEEGRGRYASPplltvqderaiDEADTVMSFVNKVEHDVPGSRHERh 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  146 -QKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPpaGPLHVQLFPCL--------SPLLLDARTLDpqgAPPAGWEVFD 216
Cdd:pfam00688 110 rKRFWFNLSEIPEGELVTSAELRLYRDKVKERTSN--ETFRISVYQVLkehagrdaSLRLLDSRLVT---ASEEGWLSFD 184
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109086985  217 VWQGLRH---QPWKQLCLELRAAWGEPDAREaethargpqqpppPDLRSLGFGRRVRPPQERALLVVF 281
Cdd:pfam00688 185 VTEALNRwlaNPEENLGLQLSVHTSDRPGRE-------------VRPSRSGLVGRRGWPQKQPFLVTF 239
PHA02913 PHA02913
TGF-beta-like protein; Provisional
354-454 1.42e-07

TGF-beta-like protein; Provisional


Pssm-ID: 177497  Cd Length: 172  Bit Score: 51.17  E-value: 1.42e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 354 CSKKPLHVNFK-ELGWDdWIIAPLEYEAYHCEGVCDFplrSHLEPTNHAIIQTLMNSMdPGSTPPSCCVPTKLTPISILY 432
Cdd:PHA02913  77 CCIRDFNIDFKaDMGMK-WILKPEGTHANLCIGICSI---SNHKKINLMYGTAFKHHM-PDNTIPFCCAPIKMKNFIIAY 151
                         90       100
                 ....*....|....*....|..
gi 109086985 433 IDaGNNVVYKQYEDMVVESCGC 454
Cdd:PHA02913 152 KE-GRKIKTDNIKNFKILECAC 172
PHA03132 PHA03132
thymidine kinase; Provisional
194-364 1.83e-03

thymidine kinase; Provisional


Pssm-ID: 222997  Cd Length: 580  Bit Score: 40.52  E-value: 1.83e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 194 PLLLDARTLDPQGAPPAGweVFDVWQGLRHQPWKQLclelraawgEPDAREaethaRGPQQPPPPDLRSLGFGRRVRPPQ 273
Cdd:PHA03132  53 DLYPPRETGSGGGVATST--IYTVPRPPRGPEQTLD---------KPDSLP-----ASRELPPGPTPVPPGGFRGASSPR 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 274 ERALLVVFTRSQRKNLFAemreQLGSAEAAGPGVGAEGSWPPPSGAPDAGPWLPSPGRRRRRTAFASR---HGKRHGKKS 350
Cdd:PHA03132 117 LGADSTSPRFLYQVNFPV----ILAPIGESNSSSEELSEEEEHSRPPPSESLKVKNGGKVYPKGFSKHkthKRSEFSGLT 192
                        170
                 ....*....|....
gi 109086985 351 RLRCSKKPLHVNFK 364
Cdd:PHA03132 193 KKAARKRKGSFVFK 206
 
Name Accession Description Interval E-value
TGF_beta pfam00019
Transforming growth factor beta like domain;
354-454 9.24e-59

Transforming growth factor beta like domain;


Pssm-ID: 306518  Cd Length: 101  Bit Score: 190.98  E-value: 9.24e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  354 CSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYI 433
Cdd:pfam00019   1 CCRRSLYVDFRDLGWDDWIIAPKGYNANYCSGSCPFPLSSHLNPTNHAILQSLVHSLKPRAVPKPCCVPTKLSPLSVLYY 80
                          90       100
                  ....*....|....*....|.
gi 109086985  434 DAGNNVVYKQYEDMVVESCGC 454
Cdd:pfam00019  81 DDEGNVVLKTYPDMVVEECGC 101
TGFB smart00204
Transforming growth factor-beta (TGF-beta) family; Family members are active as ...
354-455 3.09e-56

Transforming growth factor-beta (TGF-beta) family; Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types.


Pssm-ID: 214556  Cd Length: 102  Bit Score: 184.40  E-value: 3.09e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985   354 CSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYI 433
Cdd:smart00204   1 CRRRQLYVDFKDLGWDDWIIAPKGYNAYYCEGECPFPLSTSLNATNHAIVQTLVHLLGPNPVPKPCCVPTKLSPLSMLYY 80
                           90       100
                   ....*....|....*....|..
gi 109086985   434 DAGNNVVYKQYEDMVVESCGCR 455
Cdd:smart00204  81 DDDGNVVLRNYPNMVVEECGCR 102
TGFb_propeptide pfam00688
TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. ...
78-281 8.85e-31

TGF-beta propeptide; This propeptide is known as latency associated peptide (LAP) in TGF-beta. LAP is a homodimer which is disulfide linked to TGF-beta binding protein.


Pssm-ID: 307025  Cd Length: 239  Bit Score: 119.68  E-value: 8.85e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985   78 QQPRAQEPpgRGPRVVPhEYMLSIYRTYSIAEKLGINASFFQSS-----------KSANTITSFVDRGLDDLSHTPLRR- 145
Cdd:pfam00688  33 DRPRPSHP--SLPKSAP-QFMLDLYNSISEEEEEEEGRGRYASPplltvqderaiDEADTVMSFVNKVEHDVPGSRHERh 109
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985  146 -QKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPpaGPLHVQLFPCL--------SPLLLDARTLDpqgAPPAGWEVFD 216
Cdd:pfam00688 110 rKRFWFNLSEIPEGELVTSAELRLYRDKVKERTSN--ETFRISVYQVLkehagrdaSLRLLDSRLVT---ASEEGWLSFD 184
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 109086985  217 VWQGLRH---QPWKQLCLELRAAWGEPDAREaethargpqqpppPDLRSLGFGRRVRPPQERALLVVF 281
Cdd:pfam00688 185 VTEALNRwlaNPEENLGLQLSVHTSDRPGRE-------------VRPSRSGLVGRRGWPQKQPFLVTF 239
PHA02913 PHA02913
TGF-beta-like protein; Provisional
354-454 1.42e-07

TGF-beta-like protein; Provisional


Pssm-ID: 177497  Cd Length: 172  Bit Score: 51.17  E-value: 1.42e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 354 CSKKPLHVNFK-ELGWDdWIIAPLEYEAYHCEGVCDFplrSHLEPTNHAIIQTLMNSMdPGSTPPSCCVPTKLTPISILY 432
Cdd:PHA02913  77 CCIRDFNIDFKaDMGMK-WILKPEGTHANLCIGICSI---SNHKKINLMYGTAFKHHM-PDNTIPFCCAPIKMKNFIIAY 151
                         90       100
                 ....*....|....*....|..
gi 109086985 433 IDaGNNVVYKQYEDMVVESCGC 454
Cdd:PHA02913 152 KE-GRKIKTDNIKNFKILECAC 172
PHA03132 PHA03132
thymidine kinase; Provisional
194-364 1.83e-03

thymidine kinase; Provisional


Pssm-ID: 222997  Cd Length: 580  Bit Score: 40.52  E-value: 1.83e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 194 PLLLDARTLDPQGAPPAGweVFDVWQGLRHQPWKQLclelraawgEPDAREaethaRGPQQPPPPDLRSLGFGRRVRPPQ 273
Cdd:PHA03132  53 DLYPPRETGSGGGVATST--IYTVPRPPRGPEQTLD---------KPDSLP-----ASRELPPGPTPVPPGGFRGASSPR 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 109086985 274 ERALLVVFTRSQRKNLFAemreQLGSAEAAGPGVGAEGSWPPPSGAPDAGPWLPSPGRRRRRTAFASR---HGKRHGKKS 350
Cdd:PHA03132 117 LGADSTSPRFLYQVNFPV----ILAPIGESNSSSEELSEEEEHSRPPPSESLKVKNGGKVYPKGFSKHkthKRSEFSGLT 192
                        170
                 ....*....|....
gi 109086985 351 RLRCSKKPLHVNFK 364
Cdd:PHA03132 193 KKAARKRKGSFVFK 206
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH