NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1083876132|ref|XP_018628204|]
View 

Protein Classification

Myb family transcription factor (domain architecture ID 10019308)

SHAQKYF class Myb family transcription factor plays a central role in developmental processes and defense responses in plants, such as Arabidopsis thaliana HHO6 that is involved in root phosphate signaling and Solanum lycopersicum ARS1 that is involved in stomatal closure under salt acclimation

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
myb_SHAQKYF TIGR01557
myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain ...
63-118 4.77e-19

myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.


:

Pssm-ID: 130620  Cd Length: 57  Bit Score: 79.37  E-value: 4.77e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1083876132  63 PRLRWTPDLHLSFVRAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKK 118
Cdd:TIGR01557   2 PRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
 
Name Accession Description Interval E-value
myb_SHAQKYF TIGR01557
myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain ...
63-118 4.77e-19

myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.


Pssm-ID: 130620  Cd Length: 57  Bit Score: 79.37  E-value: 4.77e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1083876132  63 PRLRWTPDLHLSFVRAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKK 118
Cdd:TIGR01557   2 PRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
PLN03162 PLN03162
golden-2 like transcription factor; Provisional
22-118 1.28e-10

golden-2 like transcription factor; Provisional


Pssm-ID: 178707 [Multi-domain]  Cd Length: 526  Bit Score: 62.11  E-value: 1.28e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1083876132  22 ETIELSDDMIEKTAEGNSSSEDigNYENKSSRvrQYVRSKLP-----RLRWTPDLHLSFVRAIERLGgQERATPKLVLQM 96
Cdd:PLN03162  194 EAAKATGDVVSASDSGECSSVD--RKDNQASP--KSCKNAAPgkkkaKVDWTPELHRRFVHAVEQLG-VEKAFPSRILEL 268
                          90       100
                  ....*....|....*....|..
gi 1083876132  97 MNVRGLSIAHVKSHLQMYRSKK 118
Cdd:PLN03162  269 MGVQCLTRHNIASHLQKYRSHR 290
Myb_DNA-binding pfam00249
Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, ...
64-115 1.32e-04

Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family.


Pssm-ID: 333957 [Multi-domain]  Cd Length: 47  Bit Score: 38.68  E-value: 1.32e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1083876132  64 RLRWTPDLHLSFVRAIERLGGQeraTPKLVLQMMNvrGLSIAHVKSHLQMYR 115
Cdd:pfam00249   1 RGPWTPEEDELLIEAVEKHGNG---NWKKIAKHLP--GRTDKQCKNRWNNYL 47
 
Name Accession Description Interval E-value
myb_SHAQKYF TIGR01557
myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain ...
63-118 4.77e-19

myb-like DNA-binding domain, SHAQKYF class; This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.


Pssm-ID: 130620  Cd Length: 57  Bit Score: 79.37  E-value: 4.77e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1083876132  63 PRLRWTPDLHLSFVRAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKK 118
Cdd:TIGR01557   2 PRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
PLN03162 PLN03162
golden-2 like transcription factor; Provisional
22-118 1.28e-10

golden-2 like transcription factor; Provisional


Pssm-ID: 178707 [Multi-domain]  Cd Length: 526  Bit Score: 62.11  E-value: 1.28e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1083876132  22 ETIELSDDMIEKTAEGNSSSEDigNYENKSSRvrQYVRSKLP-----RLRWTPDLHLSFVRAIERLGgQERATPKLVLQM 96
Cdd:PLN03162  194 EAAKATGDVVSASDSGECSSVD--RKDNQASP--KSCKNAAPgkkkaKVDWTPELHRRFVHAVEQLG-VEKAFPSRILEL 268
                          90       100
                  ....*....|....*....|..
gi 1083876132  97 MNVRGLSIAHVKSHLQMYRSKK 118
Cdd:PLN03162  269 MGVQCLTRHNIASHLQKYRSHR 290
Myb_DNA-binding pfam00249
Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, ...
64-115 1.32e-04

Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family.


Pssm-ID: 333957 [Multi-domain]  Cd Length: 47  Bit Score: 38.68  E-value: 1.32e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 1083876132  64 RLRWTPDLHLSFVRAIERLGGQeraTPKLVLQMMNvrGLSIAHVKSHLQMYR 115
Cdd:pfam00249   1 RGPWTPEEDELLIEAVEKHGNG---NWKKIAKHLP--GRTDKQCKNRWNNYL 47
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH