NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|10800140|ref|NP_066406|]
View 

histone H2B type 1-B [Homo sapiens]

Protein Classification

H2B domain-containing protein (domain architecture ID 10648232)

H2B domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 6.30e-52

Histone H2B;


:

Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 6.30e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140     28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 10800140    108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
 
Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 6.30e-52

Histone H2B;


Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 6.30e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140     28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 10800140    108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
PLN00158 PLN00158
histone H2B; Provisional
12-125 5.70e-51

histone H2B; Provisional


Pssm-ID: 215081  Cd Length: 116  Bit Score: 160.63  E-value: 5.70e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140   12 KKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTIT 91
Cdd:PLN00158   3 KTPSKKPAKKAAKGAKKKGSKSKTETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKIATEAGKLARYNKKPTVT 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 10800140   92 SREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
Cdd:PLN00158  83 SREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 116
Histone pfam00125
Core histone H2A/H2B/H3/H4;
3-102 7.91e-19

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 77.84  E-value: 7.91e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140     3 EPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDT----GISSKAMGIMNSFVNDIFERIAGEA 78
Cdd:pfam00125  24 KPSSKSIIKKTRRYRPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSktdlRISADAVVALQEALEDYLVELFEDA 103
                          90       100
                  ....*....|....*....|....
gi 10800140    79 SRLAHYNKRSTITSREIQTAVRLL 102
Cdd:pfam00125 104 NLLAKHAKRVTITPKDIQLARRLR 127
 
Name Accession Description Interval E-value
H2B smart00427
Histone H2B;
28-124 6.30e-52

Histone H2B;


Pssm-ID: 197718  Cd Length: 97  Bit Score: 162.30  E-value: 6.30e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140     28 KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL 107
Cdd:smart00427   1 KKRVKKRKETYAIYIYKVLKQVHPDTGISSRAMSIMNSFVNDIFERIAAEASKLARYNKKSTLSSREIQTAVRLILPGEL 80
                           90
                   ....*....|....*..
gi 10800140    108 AKHAVSEGTKAVTKYTS 124
Cdd:smart00427  81 AKHAVSEGTKAVTKASS 97
PLN00158 PLN00158
histone H2B; Provisional
12-125 5.70e-51

histone H2B; Provisional


Pssm-ID: 215081  Cd Length: 116  Bit Score: 160.63  E-value: 5.70e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140   12 KKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTIT 91
Cdd:PLN00158   3 KTPSKKPAKKAAKGAKKKGSKSKTETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKIATEAGKLARYNKKPTVT 82
                         90       100       110
                 ....*....|....*....|....*....|....
gi 10800140   92 SREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
Cdd:PLN00158  83 SREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 116
PTZ00463 PTZ00463
histone H2B; Provisional
15-124 6.22e-38

histone H2B; Provisional


Pssm-ID: 185642  Cd Length: 117  Bit Score: 127.21  E-value: 6.22e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140   15 SKKAITKAQKKdgKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSRE 94
Cdd:PTZ00463   9 AKKAATGPDGK--KKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLVDTFEKIATEASRLCKYTRRDTLSSRE 86
                         90       100       110
                 ....*....|....*....|....*....|
gi 10800140   95 IQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124
Cdd:PTZ00463  87 IQTAIRLVLPGELAKHAVSEGTKAVTKFTS 116
Histone pfam00125
Core histone H2A/H2B/H3/H4;
3-102 7.91e-19

Core histone H2A/H2B/H3/H4;


Pssm-ID: 306605  Cd Length: 127  Bit Score: 77.84  E-value: 7.91e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10800140     3 EPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDT----GISSKAMGIMNSFVNDIFERIAGEA 78
Cdd:pfam00125  24 KPSSKSIIKKTRRYRPGTVALKEIRKYQKSTDLLIYKLPFARVVREIVKSSktdlRISADAVVALQEALEDYLVELFEDA 103
                          90       100
                  ....*....|....*....|....
gi 10800140    79 SRLAHYNKRSTITSREIQTAVRLL 102
Cdd:pfam00125 104 NLLAKHAKRVTITPKDIQLARRLR 127
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH