NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|57015410|sp|Q8NDV3.2|]
View 

RecName: Full=Structural maintenance of chromosomes protein 1B; Short=SMC protein 1B; Short=SMC-1-beta; Short=SMC-1B

Protein Classification

chromosome segregation protein SMC (domain architecture ID 11439815)

chromosome segregation protein SMC is an ATPase required for chromosome condensation and partitioning

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-1219 4.53e-126

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


:

Pssm-ID: 224117  Cd Length: 1163  Bit Score: 420.66  E-value: 4.53e-126
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHIGKPISSSASVK 81
Cdd:COG1196    2 YLKRIELKGFKSFADPTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAkNLRASKMSDLIFAGSGNRKPANYAEVE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   82 IIY-------VEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNcLVFQGTVESISVKKPKERTQF 154
Cdd:COG1196   82 LTFdnsdntlPLEYEEISVTRRIYRDGESEYYINGEKVRLKDIQDLLADSGIGKESYS-IVSQGKVEEIINAKPEERRKL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  155 FEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKK 234
Cdd:COG1196  161 IEEAAGVSKYKERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELRKE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  235 IHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKE-------NTSH 307
Cdd:COG1196  241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRErleelenELEE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  308 HLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVA 387
Cdd:COG1196  321 LEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELE 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  388 TMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTK 467
Cdd:COG1196  401 ELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLE 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  468 SRMSEFNEELNLIRSELQnagidthegkRQQKRAEVLEHLKRLYPdSVFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVV 547
Cdd:COG1196  481 KELSSLEARLDRLEAEQR----------ASQGVRAVLEALESGLP-GVYGPVAELIK-VKEKYETALEAALGNRLQAVVV 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  548 ASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQfPQLKKVIQFVCGNGLVCETMEEARH 627
Cdd:COG1196  549 ENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDAAPGFLGLASDLIDFD-PKYEPAVRFVLGDTLVVDDLEQARR 627
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  628 IALSGPERQKTVALDGTLFLKSGVISGGSsdLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRK-ETDLKQIQTLIQ 706
Cdd:COG1196  628 LARKLRIKYRIVTLDGDLVEPSGSITGGS--RNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSlKNELRSLEDLLE 705
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  707 GTQTRLKYSQNELEMIKKKhLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQhfcEEIGV 786
Cdd:COG1196  706 ELRRQLEELERQLEELKRE-LAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAK---LKEEI 781
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  787 ENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNEL 866
Cdd:COG1196  782 EELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEEL 861
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  867 MAKQQQLKDIRVTQNSSAEKVQTQIEEerkkflaVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGS 946
Cdd:COG1196  862 KEELEELEAEKEELEDELKELEEEKEE-------LEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEE 934
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  947 LDDIIEVEMGTEAEStqatidiyekeeafEIDysSLKEDLKALqsdqeieahlrlllqqvasqedillktAAPNLRALEN 1026
Cdd:COG1196  935 LEEEYEDTLETELER--------------EIE--RLEEEIEAL---------------------------GPVNLRAIEE 971
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1027 LKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQafLSPENPEEPYLEG 1106
Cdd:COG1196  972 YEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAE--LELTEPDDPLTAG 1049
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1107 ISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLK 1186
Cdd:COG1196 1050 IEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPAPFYVLDEVDAALDDANVERVARLIKEMS-KETQFIVITHR 1128
                       1210      1220      1230
                 ....*....|....*....|....*....|...
gi 57015410 1187 EEFYSRADALIGIYPEYDDCmfSRVLTLDLSQY 1219
Cdd:COG1196 1129 KGTMEAADRLVGVTMQEKGV--SKVVSVDLEEA 1159
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-1219 4.53e-126

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 420.66  E-value: 4.53e-126
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHIGKPISSSASVK 81
Cdd:COG1196    2 YLKRIELKGFKSFADPTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAkNLRASKMSDLIFAGSGNRKPANYAEVE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   82 IIY-------VEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNcLVFQGTVESISVKKPKERTQF 154
Cdd:COG1196   82 LTFdnsdntlPLEYEEISVTRRIYRDGESEYYINGEKVRLKDIQDLLADSGIGKESYS-IVSQGKVEEIINAKPEERRKL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  155 FEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKK 234
Cdd:COG1196  161 IEEAAGVSKYKERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELRKE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  235 IHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKE-------NTSH 307
Cdd:COG1196  241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRErleelenELEE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  308 HLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVA 387
Cdd:COG1196  321 LEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELE 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  388 TMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTK 467
Cdd:COG1196  401 ELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLE 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  468 SRMSEFNEELNLIRSELQnagidthegkRQQKRAEVLEHLKRLYPdSVFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVV 547
Cdd:COG1196  481 KELSSLEARLDRLEAEQR----------ASQGVRAVLEALESGLP-GVYGPVAELIK-VKEKYETALEAALGNRLQAVVV 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  548 ASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQfPQLKKVIQFVCGNGLVCETMEEARH 627
Cdd:COG1196  549 ENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDAAPGFLGLASDLIDFD-PKYEPAVRFVLGDTLVVDDLEQARR 627
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  628 IALSGPERQKTVALDGTLFLKSGVISGGSsdLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRK-ETDLKQIQTLIQ 706
Cdd:COG1196  628 LARKLRIKYRIVTLDGDLVEPSGSITGGS--RNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSlKNELRSLEDLLE 705
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  707 GTQTRLKYSQNELEMIKKKhLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQhfcEEIGV 786
Cdd:COG1196  706 ELRRQLEELERQLEELKRE-LAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAK---LKEEI 781
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  787 ENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNEL 866
Cdd:COG1196  782 EELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEEL 861
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  867 MAKQQQLKDIRVTQNSSAEKVQTQIEEerkkflaVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGS 946
Cdd:COG1196  862 KEELEELEAEKEELEDELKELEEEKEE-------LEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEE 934
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  947 LDDIIEVEMGTEAEStqatidiyekeeafEIDysSLKEDLKALqsdqeieahlrlllqqvasqedillktAAPNLRALEN 1026
Cdd:COG1196  935 LEEEYEDTLETELER--------------EIE--RLEEEIEAL---------------------------GPVNLRAIEE 971
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1027 LKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQafLSPENPEEPYLEG 1106
Cdd:COG1196  972 YEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAE--LELTEPDDPLTAG 1049
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1107 ISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLK 1186
Cdd:COG1196 1050 IEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPAPFYVLDEVDAALDDANVERVARLIKEMS-KETQFIVITHR 1128
                       1210      1220      1230
                 ....*....|....*....|....*....|...
gi 57015410 1187 EEFYSRADALIGIYPEYDDCmfSRVLTLDLSQY 1219
Cdd:COG1196 1129 KGTMEAADRLVGVTMQEKGV--SKVVSVDLEEA 1159
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The ...
3-1206 3.96e-106

RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206  Cd Length: 1162  Bit Score: 364.68  E-value: 3.96e-106
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHiGKPISSSASVK 81
Cdd:pfam02463    1 YLKRIEIEGFKSYAKTVILPFSPGFTAIVGPNGSGKSNILDAILFVLGERSAkSLRSERLSDLIHYSK-SGAFVNSAEVE 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     82 IIYVEESGEEKT-------FARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNCLVFQGTVESISVKKPKERTQF 154
Cdd:pfam02463   80 ITFDNEDHELPIdkeevsiRRRVYRGGDSEYYINGKNVTKKEVAELLESQGISPEAYNFLVQGGKIEIIAMMKPERRLEI 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    155 FEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKK 234
Cdd:pfam02463  160 EEEAAGSRLKRKKKEALKKLIEETENLAELIIDLEELKLQELKLKEQAKKALEYYQLKEKLELEEEYLLYLDYLKLNEER 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    235 IHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDV 314
Cdd:pfam02463  240 IDLLQELLRDEQEEIESSKQEIEKEEEKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKE 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    315 AKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLE 394
Cdd:pfam02463  320 SEKEKKKAEKELKKEKEEIEELEKELKELEIKREAEEEEEEELEKLQEKLEQLEEELLAKKKLESERLSSAAKLKEEELE 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    395 KLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFN 474
Cdd:pfam02463  400 LKSEEEKEAQLLLELARQLEDLLKEEKKEELEILEEEEESIELKQGKLTEEKEELEKQELKLLKDELELKKSEDLLKETQ 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    475 EELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAK 554
Cdd:pfam02463  480 LVKLQEQLELLLSRQKLEERSQKESKARSGLKVLLALIKDGVGGRIISAHGRLGDLGVAVENYKVAISTAVIVEVSATAD 559
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    555 DCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGpE 634
Cdd:pfam02463  560 EVEERQKLVRALTELPLGARKLRLLIPKLKLPLKSIAVLEIDPILNLAQLDKATLEADEDDKRAKVVEGILKDTELTK-L 638
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    635 RQKTVALDGTLFLKSGVISGGSSDLKYKARcwdekelknlrdrrsqkiqelkglMKTLRKETDLKQIQTLIQGTQTRLKY 714
Cdd:pfam02463  639 KESAKAKESGLRKGVSLEEGLAEKSEVKAS------------------------LSELTKELLEIQELQEKAESELAKEE 694
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    715 SQNELEMIKKKhlvafyqEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFqhfcEEIGVENIREFEN 794
Cdd:pfam02463  695 ILRRQLEIKKK-------EQREKEELKKLKLEAEELLADRVQEAQDKINEELKLLKQKIDEEE----EEEEKSRLKKEEK 763
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    795 KHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRshlKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLK 874
Cdd:pfam02463  764 EEEKSELSLKEKELAEEREKTEKLKVEEEKE---EKLKAQEEELRALEEELKEEAELLEEEQELIEQEEKIKEEELEELA 840
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    875 dirvtQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVE 954
Cdd:pfam02463  841 -----LELKEEQKLEKLAEEELERLEEEITKEELLQELLLKEEELEEQKLKDELESKEEKEKEEKKELEEESQKLNLLEE 915
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    955 MGTEAESTQATIDIYekeeafEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDKF 1034
Cdd:pfam02463  916 KENEIEERIKEEAEI------LLKYEEEPEELLLEEADEKEKEENNKEEEEERNKRLLLAKEELGKVNLMAIEEFEEKEE 989
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1035 QESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAP 1114
Cdd:pfam02463  990 RYNKDELEKERLEEEKKKLIRAIIEETCQRLKEFLELFVSINKGWNKVFFYLELGGSAELRLEDPDDPFSGGIEISARPP 1069
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1115 GKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLKEEFYSRAD 1194
Cdd:pfam02463 1070 GKGVKNLDLLSGGEKTLVALALIFAIQKYKPAPFYLLDEIDAALDDQNVSRVANLLKELS-KNAQFIVISLREEMLEKAD 1148
                         1210
                   ....*....|..
gi 57015410   1195 ALIGIYPEYDDC 1206
Cdd:pfam02463 1149 KLVGVTMVENGV 1160
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
3-1199 7.72e-91

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 320.09  E-value: 7.72e-91
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEK-IANLRVKNIQELIHGAHIGKPiSSSASVK 81
Cdd:TIGR02169    1 YIERIELENFKSFGKKKVIPFSKGFTVISGPNGSGKSNIGDAILFALGLSsSKAMRAERLSDLISNGKNGQS-GNEAYVT 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     82 IIYVEESGEEKTFARIIR-------GGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNcLVFQGTVESISVKKPKERTQF 154
Cdd:TIGR02169   80 VTFKNDDGKFPDELEVVRrlkvtddGKYSYYYLNGQRVRLSEIHDFLAAAGIYPEGYN-VVLQGDVTDFISMSPVERRKI 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    155 FEEISTsgelIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQA----KLEKEEAERYQSLLEELkmnkiqlQLFQLYH 230
Cdd:TIGR02169  159 IDEIAG----VAEFDRKKEKALEELEEVEENIERLDLIIDEKRQQlerlRREREKAERYQALLKEK-------REYEGYE 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    231 NEKKIHLLNTKLEHVNRDLSVKRESLSHhenivkarkkehgmLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLK 310
Cdd:TIGR02169  228 LLKEKEALERQKEAIERQLASLEEELEK--------------LTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVK 293
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    311 KldvakkSIKDSEKQCSKQEDDIKALETELADLDAAwrsfEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMT 390
Cdd:TIGR02169  294 E------KIGELEAEIASLERSIAEKERELEDAEER----LAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELK 363
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    391 QQLEKLQ------------WEQKTDEERLAFE--KRRHGEVQGNLK--------------QIKEQIEDHKKRIEKLEEYT 442
Cdd:TIGR02169  364 EELEDLRaeleevdkefaeTRDELKDYREKLEklKREINELKRELDrlqeelqrlseelaDLNAAIAGIEAKINELEEEK 443
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    443 KTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAG--IDTHEGKRQQKRAEVL-----EHLKRLYPDSV 515
Cdd:TIGR02169  444 EDKALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDRVEKELSKLQreLAEAEAQARASEERVRggravEEVLKASIQGV 523
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    516 FGRLFDLCHpIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGC-KMV 594
Cdd:TIGR02169  524 HGTVAQLGS-VGERYATAIEVAAGNRLNNVVVEDDAVAKEAIELLKRRKAGRATFLPLNKMRDERRDLSILSEDGViGFA 602
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    595 IDVIKTQfPQLKKVIQFVCGNGLVCETMEEARhiALSGPERqkTVALDGTLFLKSGVISGGSsdLKYKARCWDEKELKNL 674
Cdd:TIGR02169  603 VDLVEFD-PKYEPAFKYVFGDTLVVEDIEAAR--RLMGKYR--MVTLEGELFEKSGAMTGGS--RAPRGGILFSRSEPAE 675
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    675 RDRRSQKIQELKGLMKTLRKETD-----LKQIQTLIQGTQTRLKYSQNELEMIKKKH------LVAFYQEQSQLQSELLN 743
Cdd:TIGR02169  676 LQRLRERLEGLKRELSSLQSELRrienrLDELSQELSDASRKIGEIEKEIEQLEQEEeklkerLEELEEDLSSLEQEIEN 755
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    744 IESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHFCEEIG--VENIREFENKHVKRQQEIDQKryfykkmLTRLNVQL 821
Cdd:TIGR02169  756 VKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQaeLSKLEEEVSRIEARLREIEQK-------LNRLTLEK 828
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    822 EYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLkdirvtqnssaEKVQTQIEEERKKflaV 901
Cdd:TIGR02169  829 EYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDL-----------ESRLGDLKKERDE---L 894
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    902 DREVGKLQKEVVSIQTSLEQKRLekhnLLLDCKVQdieiillsgslddiievemgteAESTQATIDIYEKEEAFEIDYSS 981
Cdd:TIGR02169  895 EAQLRELERKIEELEAQIEKKRK----RLSELKAK----------------------LEALEEELSEIEDPKGEDEEIPE 948
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    982 LKEDLKALQSD-QEIEAHLRLLlqqvasqEDIllktaapNLRALENLKTV---RDKFQESTDAFEASRKEARLCRQEFEQ 1057
Cdd:TIGR02169  949 EELSLEDVQAElQRVEEEIRAL-------EPV-------NMLAIQEYEEVlkrLDELKEKRAKLEEERKAILERIEEYEK 1014
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1058 VKKrryDLFTQCFEHVSISIDQIYKKLcrnNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALL 1137
Cdd:TIGR02169 1015 KKR---EVFMEAFEAINENFNEIFAEL---SGGTGELILENPDDPFAGGLELSAKPKGKPVQRLEAMSGGEKSLTALSFI 1088
                         1210      1220      1230      1240      1250      1260
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57015410   1138 FAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQfQMIVISLKEEFYSRADALIGI 1199
Cdd:TIGR02169 1089 FAIQRYKPSPFYAFDEVDMFLDGVNVERVAKLIREKAGEA-QFIVVSLRSPMIEYADRAIGV 1149
ABC_SMC1_euk cd03275
ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of ...
4-148 3.19e-79

ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213242  Cd Length: 247  Bit Score: 262.12  E-value: 3.19e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAHIGKPISSSASVKII 83
Cdd:cd03275    1 LKRLELENFKSYKGRHVIGPFDRFTCIIGPNGSGKSNLMDAISFVLGEKSSHLRSKNLKDLIYRARVGKPDSNSAYVTAV 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 57015410   84 YVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNCLVFQGTVESISVKKP 148
Cdd:cd03275   81 YEDDDGEEKTFRRIITGGSSSYRINGKVVSLKEYNEELEKINILVKARNFLVFQGDVESIASKNP 145
SMC_hinge smart00968
SMC proteins Flexible Hinge Domain; This entry represents the hinge region of the SMC ...
513-628 6.38e-26

SMC proteins Flexible Hinge Domain; This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction.


Pssm-ID: 214944  Cd Length: 120  Bit Score: 106.16  E-value: 6.38e-26
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     513 DSVFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPI-NERLRELK-- 589
Cdd:smart00968    1 PGVLGRVADLIS-VDPKYETALEAALGGRLQAVVVDTEETAKKAIEFLKKNRLGRATFLPLDKIKPRSPaGSKLREALlp 79
                            90       100       110       120
                    ....*....|....*....|....*....|....*....|..
gi 57015410     590 ---GCKMVIDVIKTQfPQLKKVIQFVCGNGLVCETMEEARHI 628
Cdd:smart00968   80 epgFVGPAIDLVEYD-PELRPALEYLLGNTLVVDDLETARRL 120
PTZ00121 PTZ00121
MAEBL; Provisional
145-509 2.24e-10

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 65.16  E-value: 2.24e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   145 VKKPKERTQFFEEISTSGELIGEYEEKKRKL----QKAEEDAQFNFNKKKniAAERRQA---KLEKEEAERYQSLLEELK 217
Cdd:PTZ00121 1390 KKKADEAKKKAEEDKKKADELKKAAAAKKKAdeakKKAEEKKKADEAKKK--AEEAKKAdeaKKKAEEAKKAEEAKKKAE 1467
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   218 MNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEK-----ELKSVETLln 292
Cdd:PTZ00121 1468 EAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEEakkadEAKKAEEK-- 1545
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   293 QKRPQYIKAKE-NTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSfEKQIEEEILHKKRDIELEASQ 371
Cdd:PTZ00121 1546 KKADELKKAEElKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEE-EKKMKAEEAKKAEEAKIKAEE 1624
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   372 LDRYKELK---EQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDC 448
Cdd:PTZ00121 1625 LKKAEEEKkkvEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKA 1704
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 57015410   449 LKEKKQQEEtlvdeiEKTKSRMSEFNEELNLIRSElqNAGIDTHEGKRQQKRAEVLEHLKR 509
Cdd:PTZ00121 1705 EELKKKEAE------EKKKAEELKKAEEENKIKAE--EAKKEAEEDKKKAEEAKKDEEEKK 1757
 
Name Accession Description Interval E-value
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-1219 4.53e-126

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 420.66  E-value: 4.53e-126
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHIGKPISSSASVK 81
Cdd:COG1196    2 YLKRIELKGFKSFADPTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAkNLRASKMSDLIFAGSGNRKPANYAEVE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   82 IIY-------VEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNcLVFQGTVESISVKKPKERTQF 154
Cdd:COG1196   82 LTFdnsdntlPLEYEEISVTRRIYRDGESEYYINGEKVRLKDIQDLLADSGIGKESYS-IVSQGKVEEIINAKPEERRKL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  155 FEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKK 234
Cdd:COG1196  161 IEEAAGVSKYKERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELRKE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  235 IHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKE-------NTSH 307
Cdd:COG1196  241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRErleelenELEE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  308 HLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVA 387
Cdd:COG1196  321 LEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELE 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  388 TMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTK 467
Cdd:COG1196  401 ELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLE 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  468 SRMSEFNEELNLIRSELQnagidthegkRQQKRAEVLEHLKRLYPdSVFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVV 547
Cdd:COG1196  481 KELSSLEARLDRLEAEQR----------ASQGVRAVLEALESGLP-GVYGPVAELIK-VKEKYETALEAALGNRLQAVVV 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  548 ASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQfPQLKKVIQFVCGNGLVCETMEEARH 627
Cdd:COG1196  549 ENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDAAPGFLGLASDLIDFD-PKYEPAVRFVLGDTLVVDDLEQARR 627
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  628 IALSGPERQKTVALDGTLFLKSGVISGGSsdLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRK-ETDLKQIQTLIQ 706
Cdd:COG1196  628 LARKLRIKYRIVTLDGDLVEPSGSITGGS--RNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSlKNELRSLEDLLE 705
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  707 GTQTRLKYSQNELEMIKKKhLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQhfcEEIGV 786
Cdd:COG1196  706 ELRRQLEELERQLEELKRE-LAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAK---LKEEI 781
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  787 ENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNEL 866
Cdd:COG1196  782 EELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEEL 861
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  867 MAKQQQLKDIRVTQNSSAEKVQTQIEEerkkflaVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGS 946
Cdd:COG1196  862 KEELEELEAEKEELEDELKELEEEKEE-------LEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEE 934
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  947 LDDIIEVEMGTEAEStqatidiyekeeafEIDysSLKEDLKALqsdqeieahlrlllqqvasqedillktAAPNLRALEN 1026
Cdd:COG1196  935 LEEEYEDTLETELER--------------EIE--RLEEEIEAL---------------------------GPVNLRAIEE 971
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1027 LKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQafLSPENPEEPYLEG 1106
Cdd:COG1196  972 YEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAE--LELTEPDDPLTAG 1049
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1107 ISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLK 1186
Cdd:COG1196 1050 IEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPAPFYVLDEVDAALDDANVERVARLIKEMS-KETQFIVITHR 1128
                       1210      1220      1230
                 ....*....|....*....|....*....|...
gi 57015410 1187 EEFYSRADALIGIYPEYDDCmfSRVLTLDLSQY 1219
Cdd:COG1196 1129 KGTMEAADRLVGVTMQEKGV--SKVVSVDLEEA 1159
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The ...
3-1206 3.96e-106

RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206  Cd Length: 1162  Bit Score: 364.68  E-value: 3.96e-106
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHiGKPISSSASVK 81
Cdd:pfam02463    1 YLKRIEIEGFKSYAKTVILPFSPGFTAIVGPNGSGKSNILDAILFVLGERSAkSLRSERLSDLIHYSK-SGAFVNSAEVE 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     82 IIYVEESGEEKT-------FARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNCLVFQGTVESISVKKPKERTQF 154
Cdd:pfam02463   80 ITFDNEDHELPIdkeevsiRRRVYRGGDSEYYINGKNVTKKEVAELLESQGISPEAYNFLVQGGKIEIIAMMKPERRLEI 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    155 FEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKK 234
Cdd:pfam02463  160 EEEAAGSRLKRKKKEALKKLIEETENLAELIIDLEELKLQELKLKEQAKKALEYYQLKEKLELEEEYLLYLDYLKLNEER 239
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    235 IHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDV 314
Cdd:pfam02463  240 IDLLQELLRDEQEEIESSKQEIEKEEEKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKE 319
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    315 AKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLE 394
Cdd:pfam02463  320 SEKEKKKAEKELKKEKEEIEELEKELKELEIKREAEEEEEEELEKLQEKLEQLEEELLAKKKLESERLSSAAKLKEEELE 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    395 KLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFN 474
Cdd:pfam02463  400 LKSEEEKEAQLLLELARQLEDLLKEEKKEELEILEEEEESIELKQGKLTEEKEELEKQELKLLKDELELKKSEDLLKETQ 479
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    475 EELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAK 554
Cdd:pfam02463  480 LVKLQEQLELLLSRQKLEERSQKESKARSGLKVLLALIKDGVGGRIISAHGRLGDLGVAVENYKVAISTAVIVEVSATAD 559
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    555 DCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGpE 634
Cdd:pfam02463  560 EVEERQKLVRALTELPLGARKLRLLIPKLKLPLKSIAVLEIDPILNLAQLDKATLEADEDDKRAKVVEGILKDTELTK-L 638
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    635 RQKTVALDGTLFLKSGVISGGSSDLKYKARcwdekelknlrdrrsqkiqelkglMKTLRKETDLKQIQTLIQGTQTRLKY 714
Cdd:pfam02463  639 KESAKAKESGLRKGVSLEEGLAEKSEVKAS------------------------LSELTKELLEIQELQEKAESELAKEE 694
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    715 SQNELEMIKKKhlvafyqEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFqhfcEEIGVENIREFEN 794
Cdd:pfam02463  695 ILRRQLEIKKK-------EQREKEELKKLKLEAEELLADRVQEAQDKINEELKLLKQKIDEEE----EEEEKSRLKKEEK 763
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    795 KHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRshlKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLK 874
Cdd:pfam02463  764 EEEKSELSLKEKELAEEREKTEKLKVEEEKE---EKLKAQEEELRALEEELKEEAELLEEEQELIEQEEKIKEEELEELA 840
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    875 dirvtQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVE 954
Cdd:pfam02463  841 -----LELKEEQKLEKLAEEELERLEEEITKEELLQELLLKEEELEEQKLKDELESKEEKEKEEKKELEEESQKLNLLEE 915
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    955 MGTEAESTQATIDIYekeeafEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDKF 1034
Cdd:pfam02463  916 KENEIEERIKEEAEI------LLKYEEEPEELLLEEADEKEKEENNKEEEEERNKRLLLAKEELGKVNLMAIEEFEEKEE 989
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1035 QESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAP 1114
Cdd:pfam02463  990 RYNKDELEKERLEEEKKKLIRAIIEETCQRLKEFLELFVSINKGWNKVFFYLELGGSAELRLEDPDDPFSGGIEISARPP 1069
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1115 GKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLKEEFYSRAD 1194
Cdd:pfam02463 1070 GKGVKNLDLLSGGEKTLVALALIFAIQKYKPAPFYLLDEIDAALDDQNVSRVANLLKELS-KNAQFIVISLREEMLEKAD 1148
                         1210
                   ....*....|..
gi 57015410   1195 ALIGIYPEYDDC 1206
Cdd:pfam02463 1149 KLVGVTMVENGV 1160
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
3-1199 7.72e-91

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 320.09  E-value: 7.72e-91
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      3 HLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEK-IANLRVKNIQELIHGAHIGKPiSSSASVK 81
Cdd:TIGR02169    1 YIERIELENFKSFGKKKVIPFSKGFTVISGPNGSGKSNIGDAILFALGLSsSKAMRAERLSDLISNGKNGQS-GNEAYVT 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     82 IIYVEESGEEKTFARIIR-------GGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNcLVFQGTVESISVKKPKERTQF 154
Cdd:TIGR02169   80 VTFKNDDGKFPDELEVVRrlkvtddGKYSYYYLNGQRVRLSEIHDFLAAAGIYPEGYN-VVLQGDVTDFISMSPVERRKI 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    155 FEEISTsgelIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQA----KLEKEEAERYQSLLEELkmnkiqlQLFQLYH 230
Cdd:TIGR02169  159 IDEIAG----VAEFDRKKEKALEELEEVEENIERLDLIIDEKRQQlerlRREREKAERYQALLKEK-------REYEGYE 227
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    231 NEKKIHLLNTKLEHVNRDLSVKRESLSHhenivkarkkehgmLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLK 310
Cdd:TIGR02169  228 LLKEKEALERQKEAIERQLASLEEELEK--------------LTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVK 293
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    311 KldvakkSIKDSEKQCSKQEDDIKALETELADLDAAwrsfEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMT 390
Cdd:TIGR02169  294 E------KIGELEAEIASLERSIAEKERELEDAEER----LAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELK 363
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    391 QQLEKLQ------------WEQKTDEERLAFE--KRRHGEVQGNLK--------------QIKEQIEDHKKRIEKLEEYT 442
Cdd:TIGR02169  364 EELEDLRaeleevdkefaeTRDELKDYREKLEklKREINELKRELDrlqeelqrlseelaDLNAAIAGIEAKINELEEEK 443
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    443 KTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAG--IDTHEGKRQQKRAEVL-----EHLKRLYPDSV 515
Cdd:TIGR02169  444 EDKALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDRVEKELSKLQreLAEAEAQARASEERVRggravEEVLKASIQGV 523
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    516 FGRLFDLCHpIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGC-KMV 594
Cdd:TIGR02169  524 HGTVAQLGS-VGERYATAIEVAAGNRLNNVVVEDDAVAKEAIELLKRRKAGRATFLPLNKMRDERRDLSILSEDGViGFA 602
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    595 IDVIKTQfPQLKKVIQFVCGNGLVCETMEEARhiALSGPERqkTVALDGTLFLKSGVISGGSsdLKYKARCWDEKELKNL 674
Cdd:TIGR02169  603 VDLVEFD-PKYEPAFKYVFGDTLVVEDIEAAR--RLMGKYR--MVTLEGELFEKSGAMTGGS--RAPRGGILFSRSEPAE 675
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    675 RDRRSQKIQELKGLMKTLRKETD-----LKQIQTLIQGTQTRLKYSQNELEMIKKKH------LVAFYQEQSQLQSELLN 743
Cdd:TIGR02169  676 LQRLRERLEGLKRELSSLQSELRrienrLDELSQELSDASRKIGEIEKEIEQLEQEEeklkerLEELEEDLSSLEQEIEN 755
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    744 IESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHFCEEIG--VENIREFENKHVKRQQEIDQKryfykkmLTRLNVQL 821
Cdd:TIGR02169  756 VKSELKELEARIEELEEDLHKLEEALNDLEARLSHSRIPEIQaeLSKLEEEVSRIEARLREIEQK-------LNRLTLEK 828
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    822 EYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLkdirvtqnssaEKVQTQIEEERKKflaV 901
Cdd:TIGR02169  829 EYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDL-----------ESRLGDLKKERDE---L 894
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    902 DREVGKLQKEVVSIQTSLEQKRLekhnLLLDCKVQdieiillsgslddiievemgteAESTQATIDIYEKEEAFEIDYSS 981
Cdd:TIGR02169  895 EAQLRELERKIEELEAQIEKKRK----RLSELKAK----------------------LEALEEELSEIEDPKGEDEEIPE 948
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    982 LKEDLKALQSD-QEIEAHLRLLlqqvasqEDIllktaapNLRALENLKTV---RDKFQESTDAFEASRKEARLCRQEFEQ 1057
Cdd:TIGR02169  949 EELSLEDVQAElQRVEEEIRAL-------EPV-------NMLAIQEYEEVlkrLDELKEKRAKLEEERKAILERIEEYEK 1014
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1058 VKKrryDLFTQCFEHVSISIDQIYKKLcrnNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALL 1137
Cdd:TIGR02169 1015 KKR---EVFMEAFEAINENFNEIFAEL---SGGTGELILENPDDPFAGGLELSAKPKGKPVQRLEAMSGGEKSLTALSFI 1088
                         1210      1220      1230      1240      1250      1260
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57015410   1138 FAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQfQMIVISLKEEFYSRADALIGI 1199
Cdd:TIGR02169 1089 FAIQRYKPSPFYAFDEVDMFLDGVNVERVAKLIREKAGEA-QFIVVSLRSPMIEYADRAIGV 1149
ABC_SMC1_euk cd03275
ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of ...
4-148 3.19e-79

ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213242  Cd Length: 247  Bit Score: 262.12  E-value: 3.19e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAHIGKPISSSASVKII 83
Cdd:cd03275    1 LKRLELENFKSYKGRHVIGPFDRFTCIIGPNGSGKSNLMDAISFVLGEKSSHLRSKNLKDLIYRARVGKPDSNSAYVTAV 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 57015410   84 YVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNCLVFQGTVESISVKKP 148
Cdd:cd03275   81 YEDDDGEEKTFRRIITGGSSSYRINGKVVSLKEYNEELEKINILVKARNFLVFQGDVESIASKNP 145
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
12-1199 6.71e-79

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 283.49  E-value: 6.71e-79
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     12 FKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGE-KIANLRVKNIQELIHGAHIGKPISSSASVKIIYVEESGE 90
Cdd:TIGR02168   10 FKSFADPTTINFDKGITGIVGPNGCGKSNIVDAIRWVLGEqSAKALRGGKMEDVIFNGSETRKPLSLAEVELVFDNSDGL 89
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     91 EKTFA--------RIIRGGCSEFRFNDNLVsRSVYIAEL--------EKIGIIVkaqnclvfQGTVESISVKKPKERTQF 154
Cdd:TIGR02168   90 LPGADyseisitrRLYRDGESEYFINGQPC-RLKDIQDLfldtglgkRSYSIIE--------QGKISEIIEAKPEERRAI 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    155 FEEisTSGelIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAE--RRQAKLEK--EEAERYQSLLEELKMNKIQLQLFQLYH 230
Cdd:TIGR02168  161 FEE--AAG--ISKYKERRKETERKLERTRENLDRLEDILNEleRQLKSLERqaEKAERYKELKAELRELELALLVLRLEE 236
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    231 NEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLK 310
Cdd:TIGR02168  237 LREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLER 316
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    311 KLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEeilhKKRDIELEASQLDRYKELKEQVRKKVATMT 390
Cdd:TIGR02168  317 QLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEE----LEAELEELESRLEELEEQLETLRSKVAQLE 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    391 QQLEKLQWEQKTDEERLAFEKRRHG----EVQGNLKQIKE-QIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEK 465
Cdd:TIGR02168  393 LQIASLNNEIERLEARLERLEDRRErlqqEIEELLKKLEEaELKELQAELEELEEELEELQEELERLEEALEELREELEE 472
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    466 TKSRMSEFNEELNLIRSELQN-AGIDTHEGKRQQKRAEVLEHLKRLypDSVFGRLFDLCHpIHKKYQLAVTKVFGRFITA 544
Cdd:TIGR02168  473 AEQALDAAERELAQLQARLDSlERLQENLEGFSEGVKALLKNQSGL--SGILGVLSELIS-VDEGYEAAIEAALGGRLQA 549
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    545 IVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPIN----ERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCE 620
Cdd:TIGR02168  550 VVVENLNAAKKAIAFLKQNELGRVTFLPLDSIKGTEIQgndrEILKNIEGFLGVAKDLVKFDPKLRKALSYLLGGVLVVD 629
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    621 TMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSdlkykarcwdekELKNLRDRRSQKIQELKGLMKTLrkETDLKQ 700
Cdd:TIGR02168  630 DLDNALELAKKLRPGYRIVTLDGDLVRPGGVITGGSA------------KTNSSILERRREIEELEEKIEEL--EEKIAE 695
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    701 IQTLIQGTQTRLKYSQNELEMIKKKhLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHF 780
Cdd:TIGR02168  696 LEKALAELRKELEELEEELEQLRKE-LEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAE 774
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    781 ceeigvENIREFENKHVKRQQEIDQkryfykkmltrLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENCL 860
Cdd:TIGR02168  775 ------EELAEAEAEIEELEAQIEQ-----------LKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATE 837
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    861 QTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHNLllDCKVQDIEi 940
Cdd:TIGR02168  838 RRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELREL--ESKRSELR- 914
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    941 iLLSGSLDDIIEvEMGTEAESTQATIDiyEKEEAFEIDYSSLKEDLKALQSD-----QEIEAHLRLLLQQVASQEDIllk 1015
Cdd:TIGR02168  915 -RELEELREKLA-QLELRLEGLEVRID--NLQERLSEEYSLTLEEAEALENKieddeEEARRRLKRLENKIKELGPV--- 987
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1016 taapNLRALENLKTVRDKF----QESTDAFEASRKEARLCRQEFEQVKKRrydlFTQCFEHVSISIDQIYKKLCRNNSAQ 1091
Cdd:TIGR02168  988 ----NLAAIEEYEELKERYdfltAQKEDLTEAKETLEEAIEEIDREARER----FKDTFDQVNENFQRVFPKLFGGGEAE 1059
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   1092 -AFLSPENPEEpylEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYI 1170
Cdd:TIGR02168 1060 lRLTDPEDLLE---AGIEIFAQPPGKKNQNLSLLSGGEKALTALALLFAIFKVKPAPFCILDEVDAPLDDANVERFANLL 1136
                         1210      1220
                   ....*....|....*....|....*....
gi 57015410   1171 KEQTqDQFQMIVISLKEEFYSRADALIGI 1199
Cdd:TIGR02168 1137 KEFS-KNTQFIVITHNKGTMEVADQLYGV 1164
ABC_SMC1_euk cd03275
ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of ...
1113-1216 3.94e-64

ATP-binding cassette domain of eukaryotic SMC1 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213242  Cd Length: 247  Bit Score: 220.14  E-value: 3.94e-64
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1113 APGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSR 1192
Cdd:cd03275  145 PPGKRFRDMDNLSGGEKTMAALALLFAIHSYQPAPFFVLDEVDAALDNTNVGKVASYIREQAGPNFQFIVISLKEEFFSK 224
                         90       100
                 ....*....|....*....|....
gi 57015410 1193 ADALIGIYPEYdDCMFSRVLTLDL 1216
Cdd:cd03275  225 ADALVGVYRDQ-ECNSSKVLTLDL 247
ABC_SMC_barmotin cd03278
ATP-binding cassette domain of barmotin, a member of the SMC protein family; Barmotin is a ...
1113-1199 1.52e-27

ATP-binding cassette domain of barmotin, a member of the SMC protein family; Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213245  Cd Length: 197  Bit Score: 113.33  E-value: 1.52e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1113 APGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLKEEFYSR 1192
Cdd:cd03278  103 APGKKVQRLSLLSGGEKALTALALLFAIFRVRPSPFCVLDEVDAALDDANVERFARLLKEFS-KETQFIVITHRKGTMEA 181

                 ....*..
gi 57015410 1193 ADALIGI 1199
Cdd:cd03278  182 ADRLYGV 188
SMC_hinge smart00968
SMC proteins Flexible Hinge Domain; This entry represents the hinge region of the SMC ...
513-628 6.38e-26

SMC proteins Flexible Hinge Domain; This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction.


Pssm-ID: 214944  Cd Length: 120  Bit Score: 106.16  E-value: 6.38e-26
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     513 DSVFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPI-NERLRELK-- 589
Cdd:smart00968    1 PGVLGRVADLIS-VDPKYETALEAALGGRLQAVVVDTEETAKKAIEFLKKNRLGRATFLPLDKIKPRSPaGSKLREALlp 79
                            90       100       110       120
                    ....*....|....*....|....*....|....*....|..
gi 57015410     590 ---GCKMVIDVIKTQfPQLKKVIQFVCGNGLVCETMEEARHI 628
Cdd:smart00968   80 epgFVGPAIDLVEYD-PELRPALEYLLGNTLVVDDLETARRL 120
ABC_SMC4_euk cd03274
ATP-binding cassette domain of eukaryotic SMC4 proteins; The structural maintenance of ...
1114-1204 5.57e-25

ATP-binding cassette domain of eukaryotic SMC4 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213241  Cd Length: 212  Bit Score: 106.23  E-value: 5.57e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1114 PGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQfQMIVISLKEEFYSRA 1193
Cdd:cd03274  118 PKKSWKNISNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA-QFIVISLRNNMFELA 196
                         90
                 ....*....|.
gi 57015410 1194 DALIGIYPEYD 1204
Cdd:cd03274  197 DRLVGIYKTNN 207
ABC_SMC_head cd03239
The SMC head domain belongs to the ATP-binding cassette superfamily; The structural ...
1124-1200 9.01e-23

The SMC head domain belongs to the ATP-binding cassette superfamily; The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.


Pssm-ID: 213206  Cd Length: 178  Bit Score: 98.92  E-value: 9.01e-23
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 57015410 1124 LSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIY 1200
Cdd:cd03239   95 LSGGEKSLSALALIFALQEIKPSPFYVLDEIDAALDPTNRRRVSDMIKEMAKHTSQFIVITLKKEMFENADKLIGVL 171
SMC_hinge pfam06470
SMC proteins Flexible Hinge Domain; This family represents the hinge region of the SMC ...
515-629 2.57e-22

SMC proteins Flexible Hinge Domain; This family represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction.


Pssm-ID: 310817  Cd Length: 116  Bit Score: 95.80  E-value: 2.57e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    515 VFGRLFDLCHpIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMV 594
Cdd:pfam06470    4 VLGRLADLIE-VDEGYEKAVEAALGGRLQAVVVDDEETAKRAIEFLKENKLGRATFLPLDRLKPRPLRPGADLKGGAGPL 82
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 57015410    595 IDVIKTQfPQLKKVIQFVCGNGLVCETMEEARHIA 629
Cdd:pfam06470   83 LDLVEYD-DEYRKAVRYLLGNTLVVDDLDEALELA 116
ABC_SMC4_euk cd03274
ATP-binding cassette domain of eukaryotic SMC4 proteins; The structural maintenance of ...
4-144 1.54e-20

ATP-binding cassette domain of eukaryotic SMC4 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213241  Cd Length: 212  Bit Score: 93.13  E-value: 1.54e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIGPF-RRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAHiGKPISSSASVKI 82
Cdd:cd03274    3 ITKLVLENFKSYAGEQVIGPFhKSFSAIVGPNGSGKSNVIDSMLFVFGFRASKMRQKKLSDLIHNSA-GHPNLDSCSVEV 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57015410   83 iyveesgeekTFARIIrggcsefrfNDNLvsrsvyiaeLEKIGIIVKAQNCLVFQGTVESIS 144
Cdd:cd03274   82 ----------HFQEII---------DKPL---------LKSKGIDLDHNRFLILQGEVEQIA 115
ABC_Class2 cd03227
ATP-binding cassette domain of non-transporter proteins; ABC-type Class 2 contains systems ...
1124-1202 2.51e-19

ATP-binding cassette domain of non-transporter proteins; ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterized by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.


Pssm-ID: 213194  Cd Length: 162  Bit Score: 88.57  E-value: 2.51e-19
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 57015410 1124 LSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIYPE 1202
Cdd:cd03227   78 LSGGEKELSALALILALASLKPRPLYILDEIDRGLDPRDGQALAEAILEHLVKGAQVIVITHLPELAELADKLIHIKKV 156
ABC_SMC_head cd03239
The SMC head domain belongs to the ATP-binding cassette superfamily; The structural ...
4-95 3.30e-18

The SMC head domain belongs to the ATP-binding cassette superfamily; The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.


Pssm-ID: 213206  Cd Length: 178  Bit Score: 85.44  E-value: 3.30e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAhiGKPISSSASVKII 83
Cdd:cd03239    1 IKQITLKNFKSYRDETVVGGSNSFNAIVGPNGSGKSNIVDAICFVLGGKAAKLRRGSLLFLAGGG--VKAGINSASVEIT 78
                         90       100
                 ....*....|....*....|....*
gi 57015410   84 Y-----------VEE--SGEEKTFA 95
Cdd:cd03239   79 FdksyflvlqgkVEQilSGGEKSLS 103
ABC_SMC2_euk cd03273
ATP-binding cassette domain of eukaryotic SMC2 proteins; The structural maintenance of ...
3-140 2.66e-17

ATP-binding cassette domain of eukaryotic SMC2 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213240  Cd Length: 251  Bit Score: 83.89  E-value: 2.66e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    3 HLELLLVENFKSWRGRQVIGPF-RRFTCIIGPNGSGKSNVMDALSFVMG-EKIANLRVKNIQELIHgaHIGKPISSSASV 80
Cdd:cd03273    2 HIKEIILDGFKSYATRTVISGFdPQFNAITGLNGSGKSNILDAICFVLGiTNLSTVRASNLQDLIY--KRGQAGITKASV 79
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 57015410   81 KIIYVEES------GEEK----TFARIIRGGCSEFRFNDNLVSRSVYIAEL-EKIGIIVKAQNCLVFQGTV 140
Cdd:cd03273   80 TIVFDNSDksqspiGFENypeiTVTRQIVLGGTNKYLINGHRAQQQRVQDLfQSVQLNVNNPHFLIMQGRI 150
ABC_SMC_barmotin cd03278
ATP-binding cassette domain of barmotin, a member of the SMC protein family; Barmotin is a ...
4-83 3.03e-17

ATP-binding cassette domain of barmotin, a member of the SMC protein family; Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213245  Cd Length: 197  Bit Score: 82.90  E-value: 3.03e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIgPF-RRFTCIIGPNGSGKSNVMDALSFVMGEKIA-NLRVKNIQELIHGAHIGKPISSSASVK 81
Cdd:cd03278    1 LKKLELKGFKSFADKTTI-PFpPGLTAIVGPNGSGKSNIIDAIRWVLGEQSAkSLRGEKMSDVIFAGSETRKPANFAEVT 79

                 ..
gi 57015410   82 II 83
Cdd:cd03278   80 LT 81
ABC_SMC2_euk cd03273
ATP-binding cassette domain of eukaryotic SMC2 proteins; The structural maintenance of ...
1124-1196 1.08e-14

ATP-binding cassette domain of eukaryotic SMC2 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213240  Cd Length: 251  Bit Score: 75.80  E-value: 1.08e-14
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 57015410 1124 LSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALD--NT-NIGKVssyIKEQ-TQDQFqmIVISLKEEFYSRADAL 1196
Cdd:cd03273  167 LSGGQRSLVALSLILALLLFKPAPMYILDEVDAALDlsHTqNIGRM---IKTHfKGSQF--IVVSLKEGMFNNANVL 238
ABC_SMC3_euk cd03272
ATP-binding cassette domain of eukaryotic SMC3 proteins; The structural maintenance of ...
1121-1199 3.88e-12

ATP-binding cassette domain of eukaryotic SMC3 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213239  Cd Length: 243  Bit Score: 67.67  E-value: 3.88e-12
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 57015410 1121 MDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTqDQFQMIVISLKEEFYSRADALIGI 1199
Cdd:cd03272  156 MQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDAALDAQYRTAVANMIKELS-DGAQFITTTFRPELLEVADKFYGV 233
ABC_SMC3_euk cd03272
ATP-binding cassette domain of eukaryotic SMC3 proteins; The structural maintenance of ...
7-159 4.75e-12

ATP-binding cassette domain of eukaryotic SMC3 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213239  Cd Length: 243  Bit Score: 67.29  E-value: 4.75e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    7 LLVENFKSWRGRQVIGPFR-RFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIH-GAhigKPISSSASVKII- 83
Cdd:cd03272    4 VIIQGFKSYKDQTVIEPFSpKHNVVVGRNGSGKSNFFAAIRFVLSDEYTHLREEQRQALLHeGS---GPSVMSAYVEIIf 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   84 -----YVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGI-------IVKaqnclvfQGTVESISVKKPKEr 151
Cdd:cd03272   81 dnsdnRFPIDKEEVRLRRTIGLKKDEYFLDKKNVTKNDVMNLLESAGFsrsnpyyIVP-------QGKINSLTNMKQDE- 152

                 ....*...
gi 57015410  152 TQFFEEIS 159
Cdd:cd03272  153 QQEMQQLS 160
PTZ00121 PTZ00121
MAEBL; Provisional
145-509 2.24e-10

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 65.16  E-value: 2.24e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   145 VKKPKERTQFFEEISTSGELIGEYEEKKRKL----QKAEEDAQFNFNKKKniAAERRQA---KLEKEEAERYQSLLEELK 217
Cdd:PTZ00121 1390 KKKADEAKKKAEEDKKKADELKKAAAAKKKAdeakKKAEEKKKADEAKKK--AEEAKKAdeaKKKAEEAKKAEEAKKKAE 1467
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   218 MNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEK-----ELKSVETLln 292
Cdd:PTZ00121 1468 EAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEEakkadEAKKAEEK-- 1545
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   293 QKRPQYIKAKE-NTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSfEKQIEEEILHKKRDIELEASQ 371
Cdd:PTZ00121 1546 KKADELKKAEElKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEE-EKKMKAEEAKKAEEAKIKAEE 1624
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   372 LDRYKELK---EQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDC 448
Cdd:PTZ00121 1625 LKKAEEEKkkvEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKA 1704
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 57015410   449 LKEKKQQEEtlvdeiEKTKSRMSEFNEELNLIRSElqNAGIDTHEGKRQQKRAEVLEHLKR 509
Cdd:PTZ00121 1705 EELKKKEAE------EKKKAEELKKAEEENKIKAE--EAKKEAEEDKKKAEEAKKDEEEKK 1757
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
7-505 1.08e-09

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 62.86  E-value: 1.08e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    7 LLVENFKSWRGRQVIGPFRR-FTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAhigkpiSSSASVKIIYV 85
Cdd:COG0419    6 LRLKNFRSFKDIDIEKLFDSgIFLIVGPNGAGKSSILDAITFALYGKTPRLGAFSLDDLIRAG------EKSASVELEFE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   86 EESGEEKTFARIIRGG--------CSEFRFNDNLVSRSVYIAELEKIGIIVKAQNC---LVFQGTVESISVKKPKERTQF 154
Cdd:COG0419   80 VNGKKYRIEREFRRGRgqstgslqIIEVDGERIADGKKDVNEKIEELLGLDKDTFTrsvYLPQGEFDAFLKSKPKERKEI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  155 FEEIStsgeLIGEYEEKKRKLQKAEEDAqfnfnkkkniaaerrqakleKEEAERYQSLLEELKMNKIQLqlfqlyhnekk 234
Cdd:COG0419  160 LDELF----GLEKYEKLSELLKEVIKEA--------------------KAKIEELEGQLSELLEDIEDL----------- 204
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  235 ihLLNTKLEHVNRDLSVKRESLSHHENIVKARKkehgmltrQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDV 314
Cdd:COG0419  205 --LEALEEELKELKKLEEIQEEQEEEELEQEIE--------ALEERLAELEEEKERLEELKARLLEIESLELEALKIREE 274
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  315 AKKSIKDSEKQCSKQEDDIKALETELADLdaawrsfekqiEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLE 394
Cdd:COG0419  275 ELRELERLLEELEEKIERLEELEREIEEL-----------EEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLES 343
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  395 KLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFN 474
Cdd:COG0419  344 ELEELAEEKNELAKLLEERLKELEERLEELEKELEKALERLKQLEEAIQELKEELAELSAALEEIQEELEELEKELEELE 423
                        490       500       510
                 ....*....|....*....|....*....|.
gi 57015410  475 EELNLIRSELQNAGIDTHEGKRQQKRAEVLE 505
Cdd:COG0419  424 RELEELEEEIKKLEEQINQLESKELMIAELA 454
ABC_Class2 cd03227
ATP-binding cassette domain of non-transporter proteins; ABC-type Class 2 contains systems ...
11-97 2.94e-09

ATP-binding cassette domain of non-transporter proteins; ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterized by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.


Pssm-ID: 213194  Cd Length: 162  Bit Score: 58.14  E-value: 2.94e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   11 NFKSWRGRQVIGPFR-RFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNiqelihGAHIGkPISSSASVKIIY--VEE 87
Cdd:cd03227    6 RFPSYFVPNDVTFGEgSLTIITGPNGSGKSTILDAIGLALGGAQSATRRRS------GVKAG-CIVAAVSAELIFtrLQL 78
                         90
                 ....*....|
gi 57015410   88 SGEEKTFARI 97
Cdd:cd03227   79 SGGEKELSAL 88
PTZ00121 PTZ00121
MAEBL; Provisional
145-476 8.30e-09

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 60.15  E-value: 8.30e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   145 VKKPKERTQFFEEISTSGELIGEYEEKKRK---LQKAEEDAQFNFNKKKniAAERRQAKLEKEEAERYQSLLEELKMNKi 221
Cdd:PTZ00121 1430 KKKADEAKKKAEEAKKADEAKKKAEEAKKAeeaKKKAEEAKKADEAKKK--AEEAKKADEAKKKAEEAKKKADEAKKAA- 1506
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   222 qlqlfqlyHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEK--ELKSVEtllnQKRpqyi 299
Cdd:PTZ00121 1507 --------EAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKaeEKKKAE----EAK---- 1570
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   300 KAKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIEL---------EAS 370
Cdd:PTZ00121 1571 KAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLkkkeaeekkKAE 1650
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   371 QLDRYKEL----KEQVRKKVATMTQQLEKLQWEQKtDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKL---EEYTK 443
Cdd:PTZ00121 1651 ELKKAEEEnkikAAEEAKKAEEDKKKAEEAKKAEE-DEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELkkaEEENK 1729
                         330       340       350
                  ....*....|....*....|....*....|....*...
gi 57015410   444 TCMDCLK-----EKKQQEETLVDEIEKTKSRMSEFNEE 476
Cdd:PTZ00121 1730 IKAEEAKkeaeeDKKKAEEAKKDEEEKKKIAHLKKEEE 1767
PRK03918 PRK03918
chromosome segregation protein; Provisional
298-929 9.86e-09

chromosome segregation protein; Provisional


Pssm-ID: 235175  Cd Length: 880  Bit Score: 59.69  E-value: 9.86e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   298 YIKAKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLdaawrsfEKQIEEeILHKKRDIELEASQLDRYKE 377
Cdd:PRK03918  160 YENAYKNLGEVIKEIKRRIERLEKFIKRTENIEELIKEKEKELEEV-------LREINE-ISSELPELREELEKLEKEVK 231
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   378 LKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKtcmdcLKEKKQQEE 457
Cdd:PRK03918  232 ELEELKEEIEELEKELESLEGSKRKLEEKIRELEERIEELKKEIEELEEKVKELKELKEKAEEYIK-----LSEFYEEYL 306
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   458 TLVDEIEKTKSRMSefnEELNLIRSELQNAGIDTHE-GKRQQKRAEVLEHLKRLYPDSvfgRLFDLCHPIHKKYQLAVTK 536
Cdd:PRK03918  307 DELREIEKRLSRLE---EEINGIEERIKELEEKEERlEELKKKLKELEKRLEELEERH---ELYEEAKAKKEELERLKKR 380
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   537 VFGRFItaivvasEKVAKDcIRFLKEERAEPEtflaldyLDIKPINERLRELKGckmVIDVIKTQFPQLK--KVIQFVCG 614
Cdd:PRK03918  381 LTGLTP-------EKLEKE-LEELEKAKEEIE-------EEISKITARIGELKK---EIKELKKAIEELKkaKGKCPVCG 442
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   615 NglvcETMEEARHIALSgperqktvaldgtlflksgvisggssdlKYKARCWD-EKELKNLRDRRSQKIQELKGLMKTLR 693
Cdd:PRK03918  443 R----ELTEEHRKELLE----------------------------EYTAELKRiEKELKEIEEKERKLRKELRELEKVLK 490
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   694 KETDLKQIQTLIQgtqtRLKYSQNELEMIKKKHLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQ---RRIKEFQEKID 770
Cdd:PRK03918  491 KESELIKLKELAE----QLKELEEKLKKYNLEELEKKAEEYEKLKEKLIKLKGEIKSLKKELEKLEelkKKLAELEKKLD 566
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   771 KVEDDI--FQHFCEEIGVENIREFEnkhvkrqQEIDQKRYFYKKMLTRLNvqleySRSHLKKKLNKINTLKETIQKGSED 848
Cdd:PRK03918  567 ELEEELaeLLKELEELGFESVEELE-------ERLKELEPFYNEYLELKD-----AEKELEREEKELKKLEEELDKAFEE 634
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   849 IDHLKKAEENCLQTVNELMAKQQQlkdirvtqnSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHN 928
Cdd:PRK03918  635 LAETEKRLEELRKELEELEKKYSE---------EEYEELREEYLELSRELAGLRAELEELEKRREEIKKTLEKLKEELEE 705

                  .
gi 57015410   929 L 929
Cdd:PRK03918  706 R 706
PRK03918 PRK03918
chromosome segregation protein; Provisional
244-857 1.53e-08

chromosome segregation protein; Provisional


Pssm-ID: 235175  Cd Length: 880  Bit Score: 58.92  E-value: 1.53e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   244 HVNRDLSVKRESLSHHENIvKARKKEHGmltRQLQQTEKELKSvetlLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSE 323
Cdd:PRK03918  173 EIKRRIERLEKFIKRTENI-EELIKEKE---KELEEVLREINE----ISSELPELREELEKLEKEVKELEELKEEIEELE 244
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   324 KQCSKQEDDIKALETELADLDAAWRSFEKQIE--EEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQK 401
Cdd:PRK03918  245 KELESLEGSKRKLEEKIRELEERIEELKKEIEelEEKVKELKELKEKAEEYIKLSEFYEEYLDELREIEKRLSRLEEEIN 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   402 TDEERLA---FEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEY--TKTCMDCLKEKKQQE--ETLVDEIEKTKSRMSEFN 474
Cdd:PRK03918  325 GIEERIKeleEKEERLEELKKKLKELEKRLEELEERHELYEEAkaKKEELERLKKRLTGLtpEKLEKELEELEKAKEEIE 404
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   475 EELNLIRSELqnAGIDThEGKRQQKRAEVLEHLKRLYPdsVFGRLFDLCHP--IHKKYQLAVTKVFGRFITAivvasekv 552
Cdd:PRK03918  405 EEISKITARI--GELKK-EIKELKKAIEELKKAKGKCP--VCGRELTEEHRkeLLEEYTAELKRIEKELKEI-------- 471
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   553 aKDCIRFLKEERAEPETFLaldyldikpinERLRELKGCKMVIDVIKTQFPQLKKViqfvcgnglVCETMEEARHialsg 632
Cdd:PRK03918  472 -EEKERKLRKELRELEKVL-----------KKESELIKLKELAEQLKELEEKLKKY---------NLEELEKKAE----- 525
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   633 pERQKTVALDGTLflkSGVISGGSSDLKykarcwDEKELKNLRDRRSQKIQELKGLMKTLrketdLKQIQTLIQGTQTRL 712
Cdd:PRK03918  526 -EYEKLKEKLIKL---KGEIKSLKKELE------KLEELKKKLAELEKKLDELEEELAEL-----LKELEELGFESVEEL 590
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   713 KYSQNELEMIKKKHLvafyqeqsqlqsELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIfQHFCEEIGVENIREF 792
Cdd:PRK03918  591 EERLKELEPFYNEYL------------ELKDAEKELEREEKELKKLEEELDKAFEELAETEKRL-EELRKELEELEKKYS 657
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 57015410   793 ENKHVKRQQEIDQKRYFYKKMLTRLNvQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEE 857
Cdd:PRK03918  658 EEEYEELREEYLELSRELAGLRAELE-ELEKRREEIKKTLEKLKEELEEREKAKKELEKLEKALE 721
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
668-1197 4.69e-08

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 57.46  E-value: 4.69e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  668 EKELKNLRDRRSQKIQELKGLMKTLRKEtdLKQIQTLIQGTQTRLKYSQNELEMIKkkhlvafyQEQSQLQSELLNIESQ 747
Cdd:COG0419  342 ESELEELAEEKNELAKLLEERLKELEER--LEELEKELEKALERLKQLEEAIQELK--------EELAELSAALEEIQEE 411
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  748 CIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHFCEEIGVENIREFE-----------------------------NKHVK 798
Cdd:COG0419  412 LEELEKELEELERELEELEEEIKKLEEQINQLESKELMIAELAGAGekcpvcgqelpeehekellelyeleleelEEELS 491
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  799 RQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKKAEENclQTVNELMAKQQQLKDiRV 878
Cdd:COG0419  492 REKEEAELREEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELEELKEK--LQLQQLKEELRQLED-RL 568
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  879 TQNSSAEKVQTQIE---EERKKFLAVDREVGKLQKEVVSIQTSLEqkRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEM 955
Cdd:COG0419  569 QELKELLEELRLLRtrkEELEELRERLKELKKKLKELEERLSQLE--ELLQSLELSEAENELEEAEEELESELEKLNLQA 646
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  956 GTEAESTQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDIL------LKTAAPNLRALENLKT 1029
Cdd:COG0419  647 ELEELLQAALEELEEKVEELEAEIRRELQRIENEEQLEEKLEELEQLEEELEQLREELeellkkLGEIEQLIEELESRKA 726
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1030 VRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYdLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEgisY 1109
Cdd:COG0419  727 ELEELKKELEKLEKALELLEELREKLGKAGLRAD-ILRNLLAQIEAEANEILSKLSLNRYDLRRLTIRKDGNGGLV---V 802
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1110 NCVAPGKRFMPmDNLSGGEKCVAALALLFA----VHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISL 1185
Cdd:COG0419  803 VVYDGGEVRPI-KTLSGGERFLASLALRLAlsdlLQGRARLELLFLDEPFGTLDEERLEKLAEILEELLSDGRQIIIISH 881
                        570
                 ....*....|..
gi 57015410 1186 KEEFYSRADALI 1197
Cdd:COG0419  882 VEELKERADVRI 893
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
668-1062 4.89e-08

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 57.46  E-value: 4.89e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  668 EKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQTRLKYSQNELEmiKKKHLVAFYQEQSQLQSELLNIESQ 747
Cdd:COG0419  184 KAKIEELEGQLSELLEDIEDLLEALEEELKELKKLEEIQEEQEEEELEQEIEA--LEERLAELEEEKERLEELKARLLEI 261
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  748 CIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHFCEEIGVENIREFENKHVKRQQEIDQKRYFYK---KMLTRLNVQLEYS 824
Cdd:COG0419  262 ESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEELLEKLKsleERLEKLEEKLEKL 341
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  825 RSHLKKKLNKINTLKETIQKGS----EDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLA 900
Cdd:COG0419  342 ESELEELAEEKNELAKLLEERLkeleERLEELEKELEKALERLKQLEEAIQELKEELAELSAALEEIQEELEELEKELEE 421
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  901 VDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIIL---LSGSLDDIIEVEMGTEAESTQATIDIYEKEEAFEI 977
Cdd:COG0419  422 LERELEELEEEIKKLEEQINQLESKELMIAELAGAGEKCPVCgqeLPEEHEKELLELYELELEELEEELSREKEEAELRE 501
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  978 DYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALEnLKTVRDKFQESTDAFEASRKEARLCRQEFEQ 1057
Cdd:COG0419  502 EIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELEELK-EKLQLQQLKEELRQLEDRLQELKELLEELRL 580

                 ....*
gi 57015410 1058 VKKRR 1062
Cdd:COG0419  581 LRTRK 585
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
146-499 1.57e-07

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316  Cd Length: 745  Bit Score: 55.41  E-value: 1.57e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    146 KKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKN------------IAAERRQAKLEKE--EAERYQS 211
Cdd:TIGR04523  149 KKEKELEKLNNKYNDLKKQKEELENELNLLEKEKLNIQKNIDKIKNkllklelllsnlKKKIQKNKSLESQisELKKQNN 228
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    212 LLE---ELKMNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKArkkehgmLTRQLQQTEKELksvE 288
Cdd:TIGR04523  229 QLKdniEKKQQEINEKTTEISNTQTQLNQLKDEQNKIKKQLSEKQKELEQNNKKIKE-------LEKQLNQLKSEI---S 298
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    289 TLLNQKRPQYIKA-KENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEeilhKKRDIEL 367
Cdd:TIGR04523  299 DLNNQKEQDWNKElKSELKNQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESENSEKQRELEE----KQNEIEK 374
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    368 EASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEE------- 440
Cdd:TIGR04523  375 LKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQIKKLQQEKELLEKEIERLKETIIKNNSEIKDLTNqdsvkel 454
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 57015410    441 YTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAGIDTHEGKRQQK 499
Cdd:TIGR04523  455 IIKNLDNTRESLETQLKVLSRSINKIKQNLEQKQKELKSKEKELKKLNEEKKELEEKVK 513
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
139-509 3.04e-07

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 54.77  E-value: 3.04e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  139 TVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQfnfNKKKNIAAERRQAKLEKEEAERYQSLLEELK- 217
Cdd:COG0419  243 ELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELE---EKIERLEELEREIEELEEELEGLRALLEELEe 319
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  218 -MNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRP 296
Cdd:COG0419  320 lLEKLKSLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEKALERLKQLEEAIQELKEELA 399
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  297 QYIKAKENTSHHLKKLdvaKKSIKDSEKQCSKQEDDIKALETELADLdaawRSFEKQIEEEILH--------KKRDIELE 368
Cdd:COG0419  400 ELSAALEEIQEELEEL---EKELEELERELEELEEEIKKLEEQINQL----ESKELMIAELAGAgekcpvcgQELPEEHE 472
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  369 ASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDC 448
Cdd:COG0419  473 KELLELYELELEELEEELSREKEEAELREEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELEELKEKL 552
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57015410  449 LKEKKQQE-ETLVDEIEKTKSRMSEFNEeLNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKR 509
Cdd:COG0419  553 QLQQLKEElRQLEDRLQELKELLEELRL-LRTRKEELEELRERLKELKKKLKELEERLSQLE 613
PTZ00121 PTZ00121
MAEBL; Provisional
169-505 3.92e-07

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 54.76  E-value: 3.92e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   169 EEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKM----NKIQLQLFQLYHNEKKIHLLNTKLEH 244
Cdd:PTZ00121 1363 EEKAEAAEKKKEEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKaaaaKKKADEAKKKAEEKKKADEAKKKAEE 1442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   245 VNR--DLSVKRESLSHHENIVK----ARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKE--NTSHHLKKLDVAK 316
Cdd:PTZ00121 1443 AKKadEAKKKAEEAKKAEEAKKkaeeAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEakKKADEAKKAEEAK 1522
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   317 KSIKDSEKQCSKQEDDI-KALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKK----VATMTQ 391
Cdd:PTZ00121 1523 KADEAKKAEEAKKADEAkKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEArieeVMKLYE 1602
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   392 QLEKLQWEQ--KTDEERLAFEK-RRHGEVQGNLKQIKEQIEDHKKRIEKL---EEYTKTCMDCLKEKKQQEETLVDEIEK 465
Cdd:PTZ00121 1603 EEKKMKAEEakKAEEAKIKAEElKKAEEEKKKVEQLKKKEAEEKKKAEELkkaEEENKIKAAEEAKKAEEDKKKAEEAKK 1682
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 57015410   466 TKSRMSEFNEELNLIRSELQNAGIDTHEGKRQQKRAEVLE 505
Cdd:PTZ00121 1683 AEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELK 1722
recN TIGR00634
DNA repair protein RecN; All proteins in this family for which functions are known are ATP ...
25-417 5.62e-07

DNA repair protein RecN; All proteins in this family for which functions are known are ATP binding proteins involved in the initiation of recombination and recombinational repair. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273187  Cd Length: 563  Bit Score: 53.58  E-value: 5.62e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     25 RRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQE---------LIHGAHIGKPISSSASVKIIyvEESGEEKTFA 95
Cdd:TIGR00634   22 RGLTVLTGETGAGKSMIIDALSLLGGQRAGASRVRSGENravvegrftTESLDDADYPALQAIELEEE--DEDGEVILRR 99
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     96 RIIRGGCSEFRFNDNLVSRSVyIAELEKIGIIVKAQNclvfqgtvESISVKKPKERTQFFEEISTSGELIGEYEEKKRKL 175
Cdd:TIGR00634  100 SISRDGRSRAYLNGKPVSASS-LLEFTSELLDLHGQH--------DQQLLFRPDEQRQLLDTFAGANEKVKAYRELYQAW 170
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    176 QKAEEDAQFNFNKKKNIAaerrqaklekEEAERYQSLLEELKMNKIQLqlfqlyhnekkihllntkleHVNRDLSVKRES 255
Cdd:TIGR00634  171 LKARQQLKDRQQKEQELA----------QRLDFLQFQLEELEEADLQP--------------------GEDEALEAEQQR 220
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    256 LSHHENI----VKARKKEHGMLTRQ-------LQQTEKELKSVETllnqkrPQYIKAKENTSHHLKKLDVAKKSIKDSEK 324
Cdd:TIGR00634  221 LSNLEKLrelsQNALAALRGDVDVQegsllegLGEAQLALASVID------GSLRELAEQVGNALTEVEEATRELQNYLD 294
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    325 QCSKQEDDIKALETELADLDAAWRSFEKQIeEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDE 404
Cdd:TIGR00634  295 ELEFDPERLNEIEERLAQIKRLKRKYGASV-EEVLEYAEKIKEELDQLDDSDESLEALEEEVDKLEEELDKAAVALSLIR 373
                          410
                   ....*....|....*
gi 57015410    405 ERLA--FEKRRHGEV 417
Cdd:TIGR00634  374 RKAAerLAKRVEQEL 388
PRK03918 PRK03918
chromosome segregation protein; Provisional
4-510 7.24e-07

chromosome segregation protein; Provisional


Pssm-ID: 235175  Cd Length: 880  Bit Score: 53.53  E-value: 7.24e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     4 LELLLVENFKSWRGRQVigPFRR-FTCIIGPNGSGKSNVMDA----LSFVMGEKIANLRVKNIQElihgahigkpISSSA 78
Cdd:PRK03918    3 IEELKIKNFRSHKSSVV--EFDDgINLIIGQNGSGKSSILEAilvgLYWGHGSKPKGLKKDDFTR----------IGGSG 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    79 SVKIIYVEESGEEKTFARIIRGGCSEFRFND---NLVSRSVYIAE-LEKIGIIVKAQNCL-VFQGTVESIsVKKPKERTQ 153
Cdd:PRK03918   71 TEIELKFEKNGRKYRIVRSFNRGESYLKYLDgseVLEEGDSSVREwVERLIPYHVFLNAIyIRQGEIDAI-LESDESREK 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   154 FFEEISTsgelIGEYEekkrklqkaeedaqfnfNKKKNIAAERRQAKLEKEEAERYQSLLEELKmNKIQLQLFQLYHNEK 233
Cdd:PRK03918  150 VVRQILG----LDDYE-----------------NAYKNLGEVIKEIKRRIERLEKFIKRTENIE-ELIKEKEKELEEVLR 207
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   234 KIHLLNTKLehvnRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRpQYIKAKENTSHHLKKLD 313
Cdd:PRK03918  208 EINEISSEL----PELREELEKLEKEVKELEELKEEIEELEKELESLEGSKRKLEEKIRELE-ERIEELKKEIEELEEKV 282
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   314 VAKKSIKDSEKQ-------CSKQEDDIKALETELADLDAAWRSFEKQIEE---------EILHKKRDIELEASQLDRYKE 377
Cdd:PRK03918  283 KELKELKEKAEEyiklsefYEEYLDELREIEKRLSRLEEEINGIEERIKEleekeerleELKKKLKELEKRLEELEERHE 362
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   378 LKEQVRKKVATMTQQLEKLQWEQKTD-EERLAFEKRRHGEVQGNLKQIKEQI-------EDHKKRIEKLEEYTKTCMDCL 449
Cdd:PRK03918  363 LYEEAKAKKEELERLKKRLTGLTPEKlEKELEELEKAKEEIEEEISKITARIgelkkeiKELKKAIEELKKAKGKCPVCG 442
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 57015410   450 KE-----KKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRL 510
Cdd:PRK03918  443 RElteehRKELLEEYTAELKRIEKELKEIEEKERKLRKELRELEKVLKKESELIKLKELAEQLKEL 508
ABC_ATPase cd00267
ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large ...
1124-1199 7.57e-07

ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213179  Cd Length: 157  Bit Score: 50.32  E-value: 7.57e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 57015410 1124 LSGGEKCVAALALLFAvhsfRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRA-DALIGI 1199
Cdd:cd00267   81 LSGGQRQRVALARALL----LNPDLLLLDEPTSGLDPASRERLLELLRELAEEGRTVIIVTHDPELAELAaDRVIVL 153
AAA_23 pfam13476
AAA domain;
7-223 9.08e-07

AAA domain;


Pssm-ID: 316037  Cd Length: 198  Bit Score: 50.56  E-value: 9.08e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      7 LLVENFKSWRGrQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAhigkpisssasvkiIYVE 86
Cdd:pfam13476    1 LTIENFRSFRD-QTIEFSPGLTLITGPNGAGKTTILDAIKWALYGKTSRLKRKSGEGFVKGD--------------IRIE 65
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     87 ESGEEKTFARIirggcsEFRFNDNLVSRSVYIaELEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIG 166
Cdd:pfam13476   66 LEGKGKAYVEI------TFENNDGRYTRSIER-SRELSKKKGKTLKKSILEILEIDELQQFISELLKSDKIILPLLLFLG 138
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    167 EYEEKK---RKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQL 223
Cdd:pfam13476  139 QEREEKferKDKKERLEELEKALEEKEDEKDLLEKLLQLKEKKKELEELKEELEELLKEL 198
PRK03918 PRK03918
chromosome segregation protein; Provisional
162-476 1.21e-06

chromosome segregation protein; Provisional


Pssm-ID: 235175  Cd Length: 880  Bit Score: 52.76  E-value: 1.21e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   162 GELIGEY-------EEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKmnkiQLQLFQLYHNEKK 234
Cdd:PRK03918  451 KELLEEYtaelkriEKELKEIEEKERKLRKELRELEKVLKKESELIKLKELAEQLKELEEKLK----KYNLEELEKKAEE 526
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   235 IHLLNTKLEHVNRDLSVKRESLSHheniVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKK--- 311
Cdd:PRK03918  527 YEKLKEKLIKLKGEIKSLKKELEK----LEELKKKLAELEKKLDELEEELAELLKELEELGFESVEELEERLKELEPfyn 602
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   312 ----LDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEeiLHKKRDIELEASQLDRYKELkeqvRKKVA 387
Cdd:PRK03918  603 eyleLKDAEKELEREEKELKKLEEELDKAFEELAETEKRLEELRKELEE--LEKKYSEEEYEELREEYLEL----SRELA 676
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   388 TMTQQLEKLQWEQKTDEERLAFEKRRHGEvqgnLKQIKEQIEDHKKRIEKLEEYTKTcmdCLKEKKQQEETLVDEIEKTK 467
Cdd:PRK03918  677 GLRAELEELEKRREEIKKTLEKLKEELEE----REKAKKELEKLEKALERVEELREK---VKKYKALLKERALSKVGEIA 749
                         330
                  ....*....|
gi 57015410   468 SRM-SEFNEE 476
Cdd:PRK03918  750 SEIfEELTEG 759
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
18-1010 1.37e-06

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694  Cd Length: 1311  Bit Score: 52.74  E-value: 1.37e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     18 RQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNiqELIHGAHIGKPISSSASVKIIYVEESGEEKTFARI 97
Cdd:TIGR00606   21 KQIIDFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGN--TFVHDPKVAQETDVRAQIRLQFRDVNGEECAVVRS 98
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     98 I----RGGCSEFRFNDNLVSR---------SVYIAELEK-----IGIIVKAQNCLVFQGTVESI-SVKKPKERTQFFEEI 158
Cdd:TIGR00606   99 MvctqKTKKTEFKTLEGVITRykhgekvslSSKCAEIDRemishLGVSKAVLNNVIFCHQEDSNwPLSEGKALKQKFDEI 178
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    159 STSGELIGEYE-------EKKRKLQKAEEDAQFNFNKKKNIAAERRQ--AKLEKEEAERYQSLLEELKMNKIQLQLFQLY 229
Cdd:TIGR00606  179 FSATRYIKALEtlrqvrqTQGQKVQEHQMELKYLKQYKEKACEIRDQitSKEAQLESSREIVKSYENELDPLKNRLKEIE 258
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    230 HNEKKIHLLNTKL----------EHVNRDLSVKRESL------------SHHENIVKARKKEHGMLTRQLQQTEKELKsv 287
Cdd:TIGR00606  259 HNLSKIMKLDNEIkalksrkkqmEKDNSELELKMEKVfqgtdeqlndlyHNHQRTVREKERELVDCQRELEKLNKERR-- 336
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    288 etLLNQKRPQYIkaKENTSHHLKKLDVAKKSIK-DSEKQCSKQEDDIKALETElADLDAAWRSFEKQIEEEILHKKRDIE 366
Cdd:TIGR00606  337 --LLNQEKTELL--VEQGRLQLQADRHQEHIRArDSLIQSLATRLELDGFERG-PFSERQIKNFHTLVIERQEDEAKTAA 411
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    367 LEASQLDRYKELKEQ------VRKKVATMTQQLEKLQWEQKTDEerLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEE 440
Cdd:TIGR00606  412 QLCADLQSKERLKQEqadeirDEKKGLGRTIELKKEILEKKQEE--LKFVIKELQQLEGSSDRILELDQELRKAERELSK 489
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    441 YTKTCM-DCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSELQNAGIDThegKRQQKRAEVLEHLKRLYPDSVFGRL 519
Cdd:TIGR00606  490 AEKNSLtETLKKEVKSLQNEKADLDRKLRKLDQEMEQLNHHTTTRTQMEMLT---KDKMDKDEQIRKIKSRHSDELTSLL 566
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    520 FDLchpihkKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLD--IKPINERLRELKGCKMV--- 594
Cdd:TIGR00606  567 GYF------PNKKQLEDWLHSKSKEINQTRDRLAKLNKELASLEQNKNHINNELESKEeqLSSYEDKLFDVCGSQDEesd 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    595 IDVIKTQFPQLKKVIQFVCGnglvcETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLKYKARCWD------E 668
Cdd:TIGR00606  641 LERLKEEIEKSSKQRAMLAG-----ATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEFISDLQSKLRLAPdklkstE 715
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    669 KELKNLRDRRSQKIQELKGLMKTL-RKETDLKQIQTLIQGTQTRLKYSQNELEmikkkhlvafyQEQSQLQSELLNIESQ 747
Cdd:TIGR00606  716 SELKKKEKRRDEMLGLAPGRQSIIdLKEKEIPELRNKLQKVNRDIQRLKNDIE-----------EQETLLGTIMPEEESA 784
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    748 CIMLSE-GIKERqrrikeFQEKIDKVEDDIFQHFCEEIGVENIREFenkhvkrqqeidqkryfykkmlTRLNVQLEYSRS 826
Cdd:TIGR00606  785 KVCLTDvTIMER------FQMELKDVERKIAQQAAKLQGSDLDRTV----------------------QQVNQEKQEKQH 836
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    827 HLKKKLNKINTLKETIQKGSEDIDHLKkaeenclQTVNELMAKQQQLKdirvTQNSSAEKVQTQIEEERKKFLAVDREVG 906
Cdd:TIGR00606  837 ELDTVVSKIELNRKLIQDQQEQIQHLK-------SKTNELKSEKLQIG----TNLQRRQQFEEQLVELSTEVQSLIREIK 905
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    907 KLQKEVVSIQTSLEQKRLEKHNLL----LDCKVQDIEIILLSGSLDDIIeVEMGTEAESTQATIDIYEKEEAFEIdySSL 982
Cdd:TIGR00606  906 DAKEQDSPLETFLEKDQQEKEELIsskeTSNKKAQDKVNDIKEKVKNIH-GYMKDIENKIQDGKDDYLKQKETEL--NTV 982
                         1050      1060
                   ....*....|....*....|....*....
gi 57015410    983 KEDLKALQSDQE-IEAHLRLLLQQVASQE 1010
Cdd:TIGR00606  983 NAQLEECEKHQEkINEDMRLMRQDIDTQK 1011
PTZ00121 PTZ00121
MAEBL; Provisional
145-515 1.63e-06

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 52.45  E-value: 1.63e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   145 VKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQfnfNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQlq 224
Cdd:PTZ00121 1301 KKKADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKAE---EAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEE-- 1375
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   225 lfqlyhNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHG-MLTRQLQQTEKELKSVETLlnQKRPQYIKAKE 303
Cdd:PTZ00121 1376 ------AKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAkKKADEAKKKAEEKKKADEA--KKKAEEAKKAD 1447
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   304 NTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADlDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELK--EQ 381
Cdd:PTZ00121 1448 EAKKKAEEAKKAEEAKKKAEEAKKADEAKKKAEEAKKAD-EAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKkaDE 1526
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   382 VRK-KVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQgNLKQIKEQIEDHKKRIEKLEEYTKTcmdclkEKKQQEETLV 460
Cdd:PTZ00121 1527 AKKaEEAKKADEAKKAEEKKKADELKKAEELKKAEEKK-KAEEAKKAEEDKNMALRKAEEAKKA------EEARIEEVMK 1599
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 57015410   461 DEIEKTKSRMSEFNEElnlirselQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSV 515
Cdd:PTZ00121 1600 LYEEEKKMKAEEAKKA--------EEAKIKAEELKKAEEEKKKVEQLKKKEAEEK 1646
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
156-477 1.78e-06

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316  Cd Length: 745  Bit Score: 52.33  E-value: 1.78e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    156 EEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAER----RQAKLEKEEAERYQSLLEELKmNKIQLQLFQLYHN 231
Cdd:TIGR04523  117 EQKNKLEVELNKLEKQKKENKKNIDKFLTEIKKKEKELEKLnnkyNDLKKQKEELENELNLLEKEK-LNIQKNIDKIKNK 195
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    232 EKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKK 311
Cdd:TIGR04523  196 LLKLELLLSNLKKKIQKNKSLESQISELKKQNNQLKDNIEKKQQEINEKTTEISNTQTQLNQLKDEQNKIKKQLSEKQKE 275
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    312 LDVAKKSIKDSEKQcskqeddIKALETELADL----DAAWRSFEKQIEEEILHKKRDIELEASQ----LDRYKELKEQVR 383
Cdd:TIGR04523  276 LEQNNKKIKELEKQ-------LNQLKSEISDLnnqkEQDWNKELKSELKNQEKKLEEIQNQISQnnkiISQLNEQISQLK 348
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    384 KKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEI 463
Cdd:TIGR04523  349 KELTNSESENSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDEQIKKLQQEKELLEKEI 428
                          330
                   ....*....|....
gi 57015410    464 EKTKSRMSEFNEEL 477
Cdd:TIGR04523  429 ERLKETIIKNNSEI 442
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
241-519 2.31e-06

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278  Cd Length: 420  Bit Score: 51.26  E-value: 2.31e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  241 KLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVEtllnqkrpqyikakentshhlKKLDVAKKSIK 320
Cdd:COG4942   46 EIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLR---------------------KQIADLNARLN 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  321 DSEKQCSKQEDDIKALeteladLDAAWRSFEKQIEEEILHKKrdielEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQ 400
Cdd:COG4942  105 ALEVQEREQRRRLAEQ------LAALQRSGRNPPPALLVSPE-----DAQRSVRLAIYYGALNPARAERIDALKATLKQL 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  401 KTDEERLAFEKRRH----GEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEE 476
Cdd:COG4942  174 AAVRAEIAAEQAELttllSEQRAQQAKLAQLLEERKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEAAAAKAREA 253
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 57015410  477 LNLIRSELQNAgiDTHEGKRQQKRAEVLEHLK-RLYPDSVFGRL 519
Cdd:COG4942  254 AAAAEAAAARA--RAAEAKRTGETYKPTAPEKmLISSTGGFGAL 295
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
170-472 2.70e-06

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219  Cd Length: 787  Bit Score: 51.65  E-value: 2.70e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    170 EKKRKLQKAEEDAQFNFNKK------KNIAAERRQAKLEKEEAERyqsLLEELKMNKIQLqLFQLYHNEKKIHLLNTKLe 243
Cdd:pfam05483  385 ELQKKSSELEEMTKFKNNKEveleelKKILAEDEKLLDEKKQFEK---IAEELKGKEQEL-IFLLQAREKEIHDLEIQL- 459
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    244 hvnrdlSVKRESLSHHENIVKARKKEhgMLTRQLQQTEKELKSVETLLNQKrpQYIKAKENTSHHLKKLDVAKKSIKDSE 323
Cdd:pfam05483  460 ------TAIKTSEEHYLKEVEDLKTE--LEKEKLKNIELTAHCDKLLLENK--ELTQEASDMTLELKKHQEDIINCKKQE 529
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    324 KQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHK-------KRDIELEASQLDRYKELKEQ----VRKKVATMTQQ 392
Cdd:pfam05483  530 ERMLKQIENLEEKEMNLRDELESVREEFIQKGDEVKCKldkseenARSIEYEVLKKEKQMKILENkcnnLKKQIENKNKN 609
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    393 LEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKkriEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSE 472
Cdd:pfam05483  610 IEELHQENKALKKKGSAENKQLNAYEIKVNKLELELASAK---QKFEEIIDNYQKEIEDKKISEEKLLEEVEKAKAIADE 686
ABC_Rad50 cd03240
ATP-binding cassette domain of Rad50; The catalytic domains of Rad50 are similar to the ...
4-96 2.73e-06

ATP-binding cassette domain of Rad50; The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.


Pssm-ID: 213207  Cd Length: 204  Bit Score: 49.14  E-value: 2.73e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    4 LELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVM-GEKIANLRvkniqeliHGAHIGKPI---SSSAS 79
Cdd:cd03240    1 IDKLSIRNIRSFHERSEIEFFSPLTLIVGQNGAGKTTIIEALKYALtGELPPNSK--------GGAHDPKLIregEVRAQ 72
                         90
                 ....*....|....*..
gi 57015410   80 VKIIYVEESGEEKTFAR 96
Cdd:cd03240   73 VKLAFENANGKKYTITR 89
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
167-499 3.69e-06

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219  Cd Length: 787  Bit Score: 51.26  E-value: 3.69e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    167 EYEEKKRKLQKAEEDAQFNFN-KKKNIAAERRQAKLEKEEAERYQSLLEELK--MNKIQLQLFQLYHNEKKIHLLNTKLE 243
Cdd:pfam05483  426 QFEKIAEELKGKEQELIFLLQaREKEIHDLEIQLTAIKTSEEHYLKEVEDLKteLEKEKLKNIELTAHCDKLLLENKELT 505
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    244 HVNRDLSVkrESLSHHENIVKARKKEHGMLTR--QLQQTE----KELKSVETLLNQKRPQYI----KAKENTSHHLKKLD 313
Cdd:pfam05483  506 QEASDMTL--ELKKHQEDIINCKKQEERMLKQieNLEEKEmnlrDELESVREEFIQKGDEVKckldKSEENARSIEYEVL 583
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    314 VAKKSIKDSEKQCSK-------QEDDIKALETELADLDAAWRSFEKQIEE-EILHKKRDIELEASQlDRYKELKEQVRKK 385
Cdd:pfam05483  584 KKEKQMKILENKCNNlkkqienKNKNIEELHQENKALKKKGSAENKQLNAyEIKVNKLELELASAK-QKFEEIIDNYQKE 662
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    386 VATMTQQLEKLQWE----QKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVD 461
Cdd:pfam05483  663 IEDKKISEEKLLEEvekaKAIADEAVKLQKEIDKRCQHKIAEMVALMEKHKHQYDKIIEERDSELGLYKNKEQEQSSAKA 742
                          330       340       350
                   ....*....|....*....|....*....|....*...
gi 57015410    462 EIEktkSRMSEFNEELNLIRSELQNAGIDTHEGKRQQK 499
Cdd:pfam05483  743 ALE---IELSNIKAELLSLKKQLEIEKEEKEKLKMEAK 777
CALCOCO1 pfam07888
Calcium binding and coiled-coil domain (CALCOCO1) like; Proteins found in this family are ...
175-510 3.94e-06

Calcium binding and coiled-coil domain (CALCOCO1) like; Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein coexpressed by Mus musculus (CoCoA/CALCOCO1). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1, and thus enhances transcriptional activation by a number of nuclear receptors. CALCOCO1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region.


Pssm-ID: 311715  Cd Length: 545  Bit Score: 51.00  E-value: 3.94e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    175 LQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEElKMNKIQLQLFQLYHNEkkihllnTKLEHVNRDLSVKRE 254
Cdd:pfam07888  149 LQERAELLQAQEAANRQREKEKERYKRDREQWERQRKELES-RISELKEELRHSREKH-------EELEEKQKEEQDLSE 220
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    255 SLSHHENIVKARKKEHGMLTRQLQQTEKELKsvetllnqkrpQYIKAKENtshhlkKLDVAKKSIKDSEKQCSKQEDDIK 334
Cdd:pfam07888  221 ELTQEKDALLEQRAEHEARIRELEEDIKTLT-----------QRVLERET------ELERMKERVKKAGAQRKEEEAERE 283
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    335 ALETELADLDAAWRSFEKQI---EEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKtdEERLAFEK 411
Cdd:pfam07888  284 QLQAENEALLEELRSLQERLnasERKVEGLGEELSSMAAQRDRTQAELHQARLQAAQLTLQLADASLALR--EGRARWAQ 361
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    412 RRHGeVQGNLKQIKEQIEDHKKRIEKLEEYtktcmdcLKEKKQQEETLVDEI--EKTKSR--MSEFNEELNLIRSELQNA 487
Cdd:pfam07888  362 ERET-LQQSAEADKDRILKLSAELQRLEEA-------LQEERMEREKLEVELgrEKDCNRvqLSESRRELQELKASLRVA 433
                          330       340
                   ....*....|....*....|...
gi 57015410    488 giDTHEGKRQQKRAEVLEHLKRL 510
Cdd:pfam07888  434 --QKEKEQLQAEKQELLEYIRQL 454
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
7-1008 4.96e-06

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705  Cd Length: 1042  Bit Score: 50.74  E-value: 4.96e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      7 LLVENFKSWRGRQVI--GPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIAnlRVKNIQELIHGAHIGKPISSSASVKIIY 84
Cdd:TIGR00618    6 LTLKNFGSYKGTHTIdfTALGPIFLICGKTGAGKTTLLDAITYALYGKLP--RRSEVIRSLNSLYAAPSEAAFAELEFSL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     85 veesgeektfariirgGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNclvFQGTVESISVKKPKERtqffeeISTSGEL 164
Cdd:TIGR00618   84 ----------------GTKIYRVHRTLRCTRSHRKTEQPEQLYLEQKK---GRGRILAAKKSETEEV------IHDLLKL 138
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    165 IGEYEEKKRKLQKAEEDAQFNFNKKkniaaERRQAKLEKEEAERYQSLLEELKMNKIQLqlfqlyhnEKKIHLLNTKLEH 244
Cdd:TIGR00618  139 DYKTFTRVVLLPQGEFAQFLKAKSK-----EKKELLMNLFPLDQYTQLALMEFAKKKSL--------HGKAELLTLRSQL 205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    245 VNRDLSVKRESLshhenivkarkkehgmlTRQLQQTEKELKSVETLLNQKRpqyikakeNTSHHLKKLDVAKKSIKDSEK 324
Cdd:TIGR00618  206 LTLCTPCMPDTY-----------------HERKQVLEKELKHLREALQQTQ--------QSHAYLTQKREAQEEQLKKQQ 260
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    325 QCSKQEDDIKALETELADLDAAW--RSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKT 402
Cdd:TIGR00618  261 LLKQLRARIEELRAQEAVLEETQerINRARKAAPLAAHIKAVTQIEQQAQRIHTELQSKMRSRAKLLMKRAAHVKQQSSI 340
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    403 DEERLAFEK--------RRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFN 474
Cdd:TIGR00618  341 EEQRRLLQTlhsqeihiRDAHEVATSIREISCQQHTLTQHIHTLQQQKTTLTQKLQSLCKELDILQREQATIDTRTSAFR 420
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    475 -EELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVfgRLFDLCHpiHKKYQLAVTKVfgrfitaIVVASEKVA 553
Cdd:TIGR00618  421 dLQGQLAHAKKQQELQQRYAELCAAAITCTAQCEKLEKIHLQ--ESAQSLK--EREQQLQTKEQ-------IHLQETRKK 489
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    554 KDCIRFLKEERAEPetflaldyldiKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGlvcETMEEARHIALSGP 633
Cdd:TIGR00618  490 AVVLARLLELQEEP-----------CPLCGSCIHPNPARQDIDNPGPLTRRMQRGEQTYAQLE---TSEEDVYHQLTSER 555
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    634 ERQKTvaldgtlflksgvisggssdLKYKARCWDEKELKnlrdrRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQTRLK 713
Cdd:TIGR00618  556 KQRAS--------------------LKEQMQEIQQSFSI-----LTQCDNRSKEDIPNLQNITVRLQDLTEKLSEAEDML 610
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    714 YSQNELEMIKKKHLVAFYQ--------EQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQE--------KIDKVEDDIF 777
Cdd:TIGR00618  611 ACEQHALLRKLQPEQDLQDvrlhlqqcSQELALKLTALHALQLTLTQERVREHALSIRVLPKellasrqlALQKMQSEKE 690
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    778 QHFCEEIGVENIREFENKHVKRQQEIDQKRYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKETIQKGSEDIDHLKK--- 854
Cdd:TIGR00618  691 QLTYWKEMLAQCQTLLRELETHIEEYDREFNEIENASSSLGSDLAAREDALNQSLKELMHQARTVLKARTEAHFNNNeev 770
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    855 -AEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFL-AVDREVGKLQKEVVSIQTSLEQKRLEKHNL--- 929
Cdd:TIGR00618  771 tAALQTGAELSHLAAEIQFFNRLREEDTHLLKTLEAEIGQEIPSDEdILNLQCETLVQEEEQFLSRLEEKSATLGEIthq 850
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    930 ---LLDCKVQDIEIILLSGSLDDIIEVEMGTEAESTQATIDIYEKEEAfEIDYSSLKEdlkaLQSDQEIEAHLRLLLQQV 1006
Cdd:TIGR00618  851 llkYEECSKQLAQLTQEQAKIIQLSDKLNGINQIKIQFDGDALIKFLH-EITLYANVR----LANQSEGRFHGRYADSHV 925

                   ..
gi 57015410   1007 AS 1008
Cdd:TIGR00618  926 NA 927
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
163-522 7.19e-06

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 50.14  E-value: 7.19e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  163 ELIGEYEEKKRKLQKAEEDAqfnfnKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIhllntKL 242
Cdd:COG0419  466 ELPEEHEKELLELYELELEE-----LEEELSREKEEAELREEIEELEKELRELEEELIELLELEEALKEELEE-----KL 535
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  243 EHVNRDLSvkrESLSHHENIVKARKKEHgmlTRQLQQTEKELKSVETLLNQKRPQYIKakentshhLKKLDVAKKSIKDS 322
Cdd:COG0419  536 EKLENLLE---ELEELKEKLQLQQLKEE---LRQLEDRLQELKELLEELRLLRTRKEE--------LEELRERLKELKKK 601
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  323 EKQCSKQEDDIKALETELaDLDAAWRSFEKQIEEeilhkkrdIELEASQLDRYKELKEQVRKKVATMTQQLEKLQwEQKT 402
Cdd:COG0419  602 LKELEERLSQLEELLQSL-ELSEAENELEEAEEE--------LESELEKLNLQAELEELLQAALEELEEKVEELE-AEIR 671
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  403 DEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLeeytktcmdclKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRS 482
Cdd:COG0419  672 RELQRIENEEQLEEKLEELEQLEEELEQLREELEEL-----------LKKLGEIEQLIEELESRKAELEELKKELEKLEK 740
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 57015410  483 ELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDL 522
Cdd:COG0419  741 ALELLEELREKLGKAGLRADILRNLLAQIEAEANEILSKL 780
PTZ00121 PTZ00121
MAEBL; Provisional
156-469 1.08e-05

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 49.75  E-value: 1.08e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   156 EEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERyqslLEELKMNKIQLQLFQLYHNE--K 233
Cdd:PTZ00121 1227 EAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARK----ADELKKAEEKKKADEAKKAEekK 1302
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   234 KIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKK-EHGMLTRQLQQTEKELKSVETLLNQKRPQyiKAKENTSHHLKKL 312
Cdd:PTZ00121 1303 KADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKaEEAKKAAEAAKAEAEAAADEAEAAEEKAE--AAEKKKEEAKKKA 1380
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   313 DVAKKSIKDSEK---------QCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDielEASQLDRYKELKEQVR 383
Cdd:PTZ00121 1381 DAAKKKAEEKKKadeakkkaeEDKKKADELKKAAAAKKKADEAKKKAEEKKKADEAKKKAE---EAKKADEAKKKAEEAK 1457
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   384 KkvatmTQQLEKlqweqKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEI 463
Cdd:PTZ00121 1458 K-----AEEAKK-----KAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEA 1527

                  ....*.
gi 57015410   464 EKTKSR 469
Cdd:PTZ00121 1528 KKAEEA 1533
PRK01156 PRK01156
chromosome segregation protein; Provisional
774-1199 1.75e-05

chromosome segregation protein; Provisional


Pssm-ID: 100796  Cd Length: 895  Bit Score: 49.13  E-value: 1.75e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   774 DDIFQHFCEEIG--VENIREFENKhvkrQQEIDQKRYFYKKMLTRLNV-----------QLEYSRSHLKKKLNKINTLKE 840
Cdd:PRK01156  468 NHIINHYNEKKSrlEEKIREIEIE----VKDIDEKIVDLKKRKEYLESeeinksineynKIESARADLEDIKIKINELKD 543
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   841 TIQKGSEDIDHLKKAEENCLQTVNElmakqQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLE 920
Cdd:PRK01156  544 KHDKYEEIKNRYKSLKLEDLDSKRT-----SWLNALAVISLIDIETNRSRSNEIKKQLNDLESRLQEIEIGFPDDKSYID 618
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   921 Q--KRLEKHNLLLDCKVQDIE-----IILLSGSLDDIIEVEMGT-EAESTQATIDIyeKEEAFEIDYSSLKEDLKALQSD 992
Cdd:PRK01156  619 KsiREIENEANNLNNKYNEIQenkilIEKLRGKIDNYKKQIAEIdSIIPDLKEITS--RINDIEDNLKKSRKALDDAKAN 696
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   993 Q-EIEAHLRLLLQQVASQEDIL------LKTAAPNLRALENLKTVRDKFqeSTDAFEAS-RKEArlcrQEFEQVKKRRYd 1064
Cdd:PRK01156  697 RaRLESTIEILRTRINELSDRIndinetLESMKKIKKAIGDLKRLREAF--DKSGVPAMiRKSA----SQAMTSLTRKY- 769
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  1065 LFTQCFEHVSISIDQIYK-KLCRNNSAQAflspenpeepylegisyncvapgkrfmpMDNLSGGEKCVAALALLFAVHSF 1143
Cdd:PRK01156  770 LFEFNLDFDDIDVDQDFNiTVSRGGMVEG----------------------------IDSLSGGEKTAVAFALRVAVAQF 821
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 57015410  1144 RPA--PFFVLDEVDAALDN---TNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGI 1199
Cdd:PRK01156  822 LNNdkSLLIMDEPTAFLDEdrrTNLKDIIEYSLKDSSDIPQVIMISHHRELLSVADVAYEV 882
DNA_S_dndD TIGR03185
DNA sulfur modification protein DndD; This model describes the DndB protein encoded by an ...
4-477 2.11e-05

DNA sulfur modification protein DndD; This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria. [DNA metabolism, Restriction/modification]


Pssm-ID: 274475  Cd Length: 650  Bit Score: 48.53  E-value: 2.11e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      4 LELLLVENFKSWRGRQVIG----PFRRFTCIIGPNGSGKSNVMDALSFVMGEKIA---NLRVKNIQELIHGA-HIGKPIS 75
Cdd:TIGR03185    3 ILQLTLENFGPYRGRQTFDlspsSPKPIILIGGLNGAGKTTLLDAIQLALYGKRAlcsGRGNKSYEQYLRGLiNRQAGKT 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     76 SSASVKIIYVEESGEEKTFARIIRggcsEFRFNDNLVSRSV------------------YIAELEKIGIIvkaqNCLVFQ 137
Cdd:TIGR03185   83 NPASITLTFSVVEGGKRHEYTLVR----SWHINNKDVKEKLtvykddeeddslndiwdeFINELLPLELA----DLFFFD 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    138 GtvESIS-VKKPKERTQFFEEISTSG---ELIGEYE------EKKRKLQKAEEDAQfnfnkkKNIAAERRQaklEKEEAE 207
Cdd:TIGR03185  155 G--EKIEaLANPDRLASLLKEAIEVLlglDLIDRLAgdltnvLRRRKKSELPSSIL------SEIEALEAE---LKEQSE 223
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    208 RYQSLLEELKMNKIQLQlfqlyHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSV 287
Cdd:TIGR03185  224 KYEDLAQEIAHLRNELE-----EAQRSLESLEKKFRSEGGDLFEEREQLERQLKEIEAARKANRAQLRELAADPLPLLLI 298
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    288 ETLLNQKRPQYikAKENTSHHLKKLDVA----KKSIKDSEKQCSKQEDDIKALETELADLDAA--------WRSFEKQIE 355
Cdd:TIGR03185  299 PNLLDSTKAQL--QKEEQSQQNQLTQEEleerDKELLESLPKLALPAEHVKEIAAELAEIDKPattdseipHRLSGSELT 376
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    356 E-----------------EILHKKRDIELEASQLDRYKEL---KEQVRKKVATMTQQLEKLQWEQKTDEERLAfekrrhg 415
Cdd:TIGR03185  377 QlevliqqvkrelqdaksQLLKELRELEEELAEVDKKISTipsEEQIAQLLEELGEAQNELFRSEAEIEELLR------- 449
                          490       500       510       520       530       540
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57015410    416 evqgNLKQIKEQIEDHKKrieKLEEYTKTcmdclKEKKQQEETLVDEIEKTKSRMSEFNEEL 477
Cdd:TIGR03185  450 ----QLETLKEAIEALRK---TLDEKTKQ-----KINAFELERAITIADKAKKTLKEFREKL 499
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
241-440 2.69e-05

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809  Cd Length: 499  Bit Score: 48.10  E-value: 2.69e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  241 KLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVAKKSIK 320
Cdd:COG4372   75 QLDDIRPQLRALRTELGTAQGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELARLTKQAQDLQTRLK 154
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  321 DSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRdIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQ 400
Cdd:COG4372  155 TLAEQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLRSAQ-IEQEAQNLATRANAAQARTEELARRAAAAQQTAQAI 233
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 57015410  401 KTdeerlafekrRHGEVQGNLKQIKEQIEDHKKRIEKLEE 440
Cdd:COG4372  234 QQ----------RDAQISQKAQQIAARAEQIRERERQLQR 263
ABC_Rad50 cd03240
ATP-binding cassette domain of Rad50; The catalytic domains of Rad50 are similar to the ...
1120-1197 2.92e-05

ATP-binding cassette domain of Rad50; The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.


Pssm-ID: 213207  Cd Length: 204  Bit Score: 46.45  E-value: 2.92e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410 1120 PMDNLSGGEKCVAALALLFAVHSFRPA--PFFVLDEVDAALDNTNI-GKVSSYIKEQ-TQDQFQMIVISLKEEFYSRADA 1195
Cdd:cd03240  112 MRGRCSGGEKVLASLIIRLALAETFGSncGILALDEPTTNLDEENIeESLAEIIEERkSQKNFQLIVITHDEELVDAADH 191

                 ..
gi 57015410 1196 LI 1197
Cdd:cd03240  192 IY 193
APG6 pfam04111
Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. ...
273-397 3.51e-05

Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway.


Pssm-ID: 309295  Cd Length: 308  Bit Score: 47.18  E-value: 3.51e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    273 LTRQLQQTEKELKSVETLLNQKRPQYIKAKEntshhlkkLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFE- 351
Cdd:pfam04111   14 LDKELEQLEKERDAYQEFLKKLEKEKPSDEE--------IEALEKELEKLEKEEEELLQELEELEKEREELDAELEKLEe 85
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|.
gi 57015410    352 -----KQIEEEILHKKRDIELEASQLDrykELKEQVRKKVATMTQQLEKLQ 397
Cdd:pfam04111   86 eleelDEEEEEYWREYNAFQLELLEFQ---DERDSLENQYEHAQDQLDRLR 133
PTZ00121 PTZ00121
MAEBL; Provisional
146-470 4.08e-05

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 47.83  E-value: 4.08e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   146 KKPKERTQFFEEISTSGELIGEYEEKKRK---LQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSL--LEELKMNK 220
Cdd:PTZ00121 1470 KKADEAKKKAEEAKKADEAKKKAEEAKKKadeAKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEAkkAEEKKKAD 1549
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   221 IQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLShhENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIK 300
Cdd:PTZ00121 1550 ELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEA--KKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKK 1627
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   301 AKENTSHHLKKLDVAKKSIKDSEkQCSKQEDDIKALETELADLDAAwrsfEKQIEEEILHKKRDIELEASQLDRYKELK- 379
Cdd:PTZ00121 1628 AEEEKKKVEQLKKKEAEEKKKAE-ELKKAEEENKIKAAEEAKKAEE----DKKKAEEAKKAEEDEKKAAEALKKEAEEAk 1702
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   380 --EQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEE 457
Cdd:PTZ00121 1703 kaEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKEKEAVIE 1782
                         330
                  ....*....|...
gi 57015410   458 TLVDEiEKTKSRM 470
Cdd:PTZ00121 1783 EELDE-EDEKRRM 1794
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
159-475 4.47e-05

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316  Cd Length: 745  Bit Score: 47.71  E-value: 4.47e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    159 STSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEElKMNKIQLQLFQLYHNEKKIHLL 238
Cdd:TIGR04523  356 SENSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLESKIQNQEKLNQQKDE-QIKKLQQEKELLEKEIERLKET 434
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    239 NTKLEHVNRDL----SVKRESLSHHENIVKARKKEHGMLTRQ-------LQQTEKELKSVETLLNQKRPQYIKAKENTSH 307
Cdd:TIGR04523  435 IIKNNSEIKDLtnqdSVKELIIKNLDNTRESLETQLKVLSRSinkikqnLEQKQKELKSKEKELKKLNEEKKELEEKVKD 514
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    308 HLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSfeKQIEEEILHKKRDIE--------LEASQlDRYKELK 379
Cdd:TIGR04523  515 LTKKISSLKEKIEKLESEKKEKESKISDLEDELNKDDFELKK--ENLEKEIDEKNKEIEelkqtqksLKKKQ-EEKQELI 591
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    380 EQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHgevqgnlKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETL 459
Cdd:TIGR04523  592 DQKEKEKKDLIKEIEEKEKKISSLEKELEKAKKEN-------EKLSSIIKNIKSKKNKLKQEVKQIKETIKEIRNKWPEI 664
                          330
                   ....*....|....*.
gi 57015410    460 VDEIEKTKSRMSEFNE 475
Cdd:TIGR04523  665 IKKIKESKTKIDDIIE 680
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
105-358 6.18e-05

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809  Cd Length: 499  Bit Score: 46.94  E-value: 6.18e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  105 FRFNDNLVSRsvyIAELEKIGIIVKAQNCLVfqGTVESISVKKPKERTQFFEEISTSGEligeyeEKKrklQKAEEDAQF 184
Cdd:COG4372   63 FLLNRNLRSG---VFQLDDIRPQLRALRTEL--GTAQGEKRAAETEREAARSELQKARQ------ERE---AVRQELAAA 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  185 NFNKKKniaAERRQAKLEKEeAERYQSLLEELKMNKIQL--QLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENI 262
Cdd:COG4372  129 RQNLAK---AQQELARLTKQ-AQDLQTRLKTLAEQRRQLeaQAQSLQASQKQLQASATQLKSQVLDLKLRSAQIEQEAQN 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  263 VKARKKehgmltrQLQQTEKELKSVETLLnQKRPQYIKAKEntshhlKKLDVAKKSIKDSEKQCSKQEDDIKALETEL-- 340
Cdd:COG4372  205 LATRAN-------AAQARTEELARRAAAA-QQTAQAIQQRD------AQISQKAQQIAARAEQIRERERQLQRLETAQar 270
                        250       260
                 ....*....|....*....|...
gi 57015410  341 -----ADLDAAWRSFEKQIEEEI 358
Cdd:COG4372  271 leqevAQLEAYYQAYVRLRQQAA 293
AAA_15 pfam13175
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
9-272 6.48e-05

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 315766  Cd Length: 324  Bit Score: 46.32  E-value: 6.48e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410      9 VENFKSWRgrQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNiqelihgahigKPISSSASVKIIYVEES 88
Cdd:pfam13175    8 IKNFRSLK--DTEIDLDDLTVLIGKNNSGKSSILEALDIFLNNSKLNFFEDS-----------ENIDFSIEIKIDVEFKL 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     89 GEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQNClvfQGTVESISVKKPKERTQFFEEISTSGELIgey 168
Cdd:pfam13175   75 KNKKNYYIDERKSVEKNKSKYELYKLKTELLNKKKNEIKIDKEDL---KKLIKKLESSFNYEELNVLKNLLPLYLLI--- 148
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    169 eEKKRKLQKAEEDAQFN--FNKKKNIAAERRQAKLEKEEAERYQSLLEELK--MNKIQLQLFQLYHNEKKIHLLNTKLEH 244
Cdd:pfam13175  149 -SADRNVSDEDSEKKSSllGKLLNIISEEANQEEVELELTEILKKTLEKLKeiDKELAEELKPENILFKIIDKIKKFGYP 227
                          250       260
                   ....*....|....*....|....*...
gi 57015410    245 VNRDLSVKRESLSHHENIVKARKKEHGM 272
Cdd:pfam13175  228 PKLNEEIEIKSYKYDDEELPLNYNGSGV 255
ABC_SMC6_euk cd03276
ATP-binding cassette domain of eukaryotic SM6 proteins; The structural maintenance of ...
1121-1162 7.19e-05

ATP-binding cassette domain of eukaryotic SM6 proteins; The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).


Pssm-ID: 213243  Cd Length: 198  Bit Score: 44.90  E-value: 7.19e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 57015410 1121 MDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTN 1162
Cdd:cd03276  107 VKTLSGGERSFSTVCLLLSLWEVMESPFRCLDEFDVFMDMVN 148
HEC1 COG5185
Protein involved in chromosome segregation, interacts with SMC proteins [Cell cycle control, ...
658-989 1.11e-04

Protein involved in chromosome segregation, interacts with SMC proteins [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227512  Cd Length: 622  Bit Score: 46.13  E-value: 1.11e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  658 DLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQ-TLIQGTQTRLKYsQNELEMIKKKHLVAFYQEQSQ 736
Cdd:COG5185  301 REKWRALKSDSNKYENYVNAMKQKSQEWPGKLEKLKSEIELKEEEiKALQSNIDELHK-QLRKQGISTEQFELMNQEREK 379
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  737 LQSELLNIESQCIMLSEGIKERQRrikEFQEKIDKVEDDIFQH--FCEEIGV--ENIREfENKHVKRQQEIDQKRYFYKK 812
Cdd:COG5185  380 LTRELDKINIQSDKLTKSVKSRKL---EAQGIFKSLEKTLRQYdsLIQNITRsrSQIGH-NVNDSSLKINIEQLFPKGSG 455
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  813 MltrlnvqleysRSHLKKKLNKIN-TLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQI 891
Cdd:COG5185  456 I-----------NESIKKSILELNdEIQERIKTEENKSITLEEDIKNLKHDINELTQILEKLELELSEANSKFELSKEEN 524
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  892 EEERKKFlavDREVGKLQKEvvsiqtsLEQKRLEKHNLLLDC--KVQDIEIIllsgsLDDIIEVEMGTEAESTQATIDIY 969
Cdd:COG5185  525 ERELVAQ---RIEIEKLEKE-------LNDLNLLSKTSILDAeqLVQSTEIK-----LDELKVDLNRKRYKIHKQVIHVI 589
                        330       340
                 ....*....|....*....|
gi 57015410  970 EKEEAFEIDYSSLKEDLKAL 989
Cdd:COG5185  590 DITSKFKINIQSSLEDLENE 609
AAA_21 pfam13304
AAA domain, putative AbiEii toxin, Type IV TA system; Several members are annotated as being ...
27-235 1.14e-04

AAA domain, putative AbiEii toxin, Type IV TA system; Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.


Pssm-ID: 315880  Cd Length: 303  Bit Score: 45.51  E-value: 1.14e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410     27 FTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIHGAHIGKPISSSASVKIIYVEESGEEKTFARIIRggcSEFR 106
Cdd:pfam13304    1 LNVLIGPNGSGKSNLLEALRFLARFDDLVRGLTDERSGNGGIGGIPSLLDGNDPKEPIEFEIEEFLLDGVRYR---YGLE 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    107 FNDNLVSRSVY-IAELEKIGIIVKAQNClvFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFN 185
Cdd:pfam13304   78 LGREDVEEKLSsKPTLLESRLLRREDSE--IREDKFPDEAEEFRSLLSVEERINLSLSELSDLISGLLLLSIISPLSSLL 155
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|..
gi 57015410    186 FNKKKNIAAERRQAKLEKEEAErYQSLLEELK--MNKIQLQLFQLYHNEKKI 235
Cdd:pfam13304  156 LNDRGLLKEDIALLDLAADLYL-GPDLLELLQrlVRGLKLLDLKLSDLGEGI 206
PRK02224 PRK02224
chromosome segregation protein; Provisional
185-510 1.21e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 46.19  E-value: 1.21e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   185 NFNKKKNIAAERRQ-AKLEKEEAERYQSLLEELKMNKIQLQlfqlyhneKKIHLLNTKLEHVNRDLSVKRESLSHHENIV 263
Cdd:PRK02224  224 RYEEQREQARETRDeADEVLEEHEERREELETLEAEIEDLR--------ETIAETEREREELAEEVRDLRERLEELEEER 295
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   264 KARKKEHGM-------LTRQLQQTEKELKSVETLLNQKRPQyikakenTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKAL 336
Cdd:PRK02224  296 DDLLAEAGLddadaeaVEARREELEDRDEELRDRLEECRVA-------AQAHNEEAESLREDADDLEERAEELREEAAEL 368
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   337 ETELADLDAAWRSFEKQIEE---EILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLA----- 408
Cdd:PRK02224  369 ESELEEAREAVEDRREEIEEleeEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERVEeaeal 448
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   409 ----------------------FEKR-RHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTC--MDCLKEKKQQEETLVDEI 463
Cdd:PRK02224  449 leagkcpecgqpvegsphvetiEEDReRVEELEAELEDLEEEVEEVEERLERAEDLVEAEdrIERLEERREDLEELIAER 528
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*..
gi 57015410   464 EKTKSRMSEFNEELNLIRSELQNAGiDTHEGKRQQKRAEVLEHLKRL 510
Cdd:PRK02224  529 RETIEEKRERAEELRERAAELEAEA-EEKREAAAEAEEEAEEAREEV 574
MAD pfam05557
Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint ...
170-401 1.27e-04

Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins. The mitotic spindle checkpoint monitors proper attachment of the bipolar spindle to the kinetochores of aligned sister chromatids and causes a cell cycle arrest in prometaphase when failures occur. Multiple components of the mitotic spindle checkpoint have been identified in yeast and higher eukaryotes. In S.cerevisiae, the existence of a Mad1-dependent complex containing Mad2, Mad3, Bub3 and Cdc20 has been demonstrated.


Pssm-ID: 310273  Cd Length: 660  Bit Score: 45.89  E-value: 1.27e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    170 EKKRKLQKAEEDA-----QFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQlfqlyhnekkihllntKLEH 244
Cdd:pfam05557   24 EHKRARIELERKAsalarQLERESDRNQELQKRIRLLEKREAEAEEALREQIERNRLKLK----------------NLEA 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    245 VNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVET----------LLNQKRPQYIKAKENTSHHLKKLDV 314
Cdd:pfam05557   88 LNKKLNEKESQLADAREVISCLKNELSELKRQIQRQELELSSTNSeleelqeqldLLKAKASEAEQLIQNLEAQQSSLAE 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    315 AKKSIKDSEKQCSKQEDD---IKALETELADLdAAWRSFEKQIEEEILH---KKRDIELEASQLDRYK---ELKEQVRKK 385
Cdd:pfam05557  168 AEQRIKELEFEIQSQEQDseiVKNMKSELARI-PELEKELERLREENKHlneNIENNLLLKEEVEDLKrklEREEKYREE 246
                          250
                   ....*....|....*.
gi 57015410    386 VATMTQQLEKLQWEQK 401
Cdd:pfam05557  247 LATLELENEKLEQELQ 262
Mplasa_alph_rch TIGR04523
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ...
167-484 1.33e-04

helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown.


Pssm-ID: 275316  Cd Length: 745  Bit Score: 46.17  E-value: 1.33e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    167 EYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEElKMNKIQLQLFQLyHNEKK---IHLLNTKLE 243
Cdd:TIGR04523  240 EINEKTTEISNTQTQLNQLKDEQNKIKKQLSEKQKELEQNNKKIKELEK-QLNQLKSEISDL-NNQKEqdwNKELKSELK 317
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    244 HVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSE 323
Cdd:TIGR04523  318 NQEKKLEEIQNQISQNNKIISQLNEQISQLKKELTNSESENSEKQRELEEKQNEIEKLKKENQSYKQEIKNLESQINDLE 397
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    324 KQCSKQEDDIKALETELADLDAAWRSFEKQIEEeilhKKRDIELEASQLDRYKELKEQVRKKVatmtQQLEKLQWEQKTD 403
Cdd:TIGR04523  398 SKIQNQEKLNQQKDEQIKKLQQEKELLEKEIER----LKETIIKNNSEIKDLTNQDSVKELII----KNLDNTRESLETQ 469
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    404 EERLafeKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSE 483
Cdd:TIGR04523  470 LKVL---SRSINKIKQNLEQKQKELKSKEKELKKLNEEKKELEEKVKDLTKKISSLKEKIEKLESEKKEKESKISDLEDE 546

                   .
gi 57015410    484 L 484
Cdd:TIGR04523  547 L 547
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
311-875 1.40e-04

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 45.91  E-value: 1.40e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  311 KLDVAKKSIKDSEKQCSKQEDDIKALETEL-ADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKvatm 389
Cdd:COG0419  179 VIKEAKAKIEELEGQLSELLEDIEDLLEALeEELKELKKLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEEL---- 254
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  390 TQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLvdeiektksr 469
Cdd:COG0419  255 KARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEELLEKL---------- 324
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  470 mSEFNEELNLIRSELQNAGIDTHEG--------KRQQKRAEVLEHLKRLYPDSVFGRLFDLChPIHKKYQLAVTKVFGRF 541
Cdd:COG0419  325 -KSLEERLEKLEEKLEKLESELEELaeeknelaKLLEERLKELEERLEELEKELEKALERLK-QLEEAIQELKEELAELS 402
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  542 -----ITAIVVASEKVAKDCIRFLKEERAEpETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNG 616
Cdd:COG0419  403 aaleeIQEELEELEKELEELERELEELEEE-IKKLEEQINQLESKELMIAELAGAGEKCPVCGQELPEEHEKELLELYEL 481
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  617 LVC---ETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLKYKARcWDEKELKNL---------RDRRSQKIQE 684
Cdd:COG0419  482 ELEeleEELSREKEEAELREEIEELEKELRELEEELIELLELEEALKEELE-EKLEKLENLleeleelkeKLQLQQLKEE 560
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  685 LKGLMKTLRKETDLKQIQTLIQGTQTRLKYSQNELEMIKKKhlvafyqeQSQLQSELLNIES--QCIMLSEGIKERQRRI 762
Cdd:COG0419  561 LRQLEDRLQELKELLEELRLLRTRKEELEELRERLKELKKK--------LKELEERLSQLEEllQSLELSEAENELEEAE 632
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410  763 KEFQEKIDKVEddiFQHFCEEIGVENIREFENKHVKRQQEIDQK--RYFYKKMLTRLNVQLEYSRSHLKKKLNKINTLKE 840
Cdd:COG0419  633 EELESELEKLN---LQAELEELLQAALEELEEKVEELEAEIRRElqRIENEEQLEEKLEELEQLEEELEQLREELEELLK 709
                        570       580       590
                 ....*....|....*....|....*....|....*
gi 57015410  841 TIQKGSEDIDHLKKAEENcLQTVNELMAKQQQLKD 875
Cdd:COG0419  710 KLGEIEQLIEELESRKAE-LEELKKELEKLEKALE 743
PRK03918 PRK03918
chromosome segregation protein; Provisional
149-485 1.88e-04

chromosome segregation protein; Provisional


Pssm-ID: 235175  Cd Length: 880  Bit Score: 45.44  E-value: 1.88e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   149 KERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQL 228
Cdd:PRK03918  300 EFYEEYLDELREIEKRLSRLEEEINGIEERIKELEEKEERLEELKKKLKELEKRLEELEERHELYEEAKAKKEELERLKK 379
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   229 YHNEKKIHLLNTKLEHVNRdlsvKRESLSHHENIVKARKkehgmltRQLQQTEKEL-KSVETLLNQKRPQYIKAKENTSH 307
Cdd:PRK03918  380 RLTGLTPEKLEKELEELEK----AKEEIEEEISKITARI-------GELKKEIKELkKAIEELKKAKGKCPVCGRELTEE 448
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   308 HLKKLdvakksIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEilhkkrdieleaSQLDRYKELKEQVRKkva 387
Cdd:PRK03918  449 HRKEL------LEEYTAELKRIEKELKEIEEKERKLRKELRELEKVLKKE------------SELIKLKELAEQLKE--- 507
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   388 tMTQQLEKLqweqktDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTK 467
Cdd:PRK03918  508 -LEEKLKKY------NLEELEKKAEEYEKLKEKLIKLKGEIKSLKKELEKLEELKKKLAELEKKLDELEEELAELLKELE 580
                         330
                  ....*....|....*...
gi 57015410   468 SRMSEFNEELNLIRSELQ 485
Cdd:PRK03918  581 ELGFESVEELEERLKELE 598
COG4637 COG4637
Predicted ATPase [General function prediction only];
4-48 2.01e-04

Predicted ATPase [General function prediction only];


Pssm-ID: 226984  Cd Length: 373  Bit Score: 44.79  E-value: 2.01e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 57015410    4 LELLLVENFKSWRgrQVIGPFRRFTCIIGPNGSGKSNVMDALSFV 48
Cdd:COG4637    3 LVSIKVKNYRSFR--SLDLEIRRVNVIIGANGAGKSNFYDALRLL 45
PRK02224 PRK02224
chromosome segregation protein; Provisional
245-510 2.06e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 45.42  E-value: 2.06e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   245 VNRDLSVKRESLSHHENIVKArkKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKEntshhlkKLDVAKKSIKDSEK 324
Cdd:PRK02224  178 VERVLSDQRGSLDQLKAQIEE--KEEKDLHERLNGLESELAELDEEIERYEEQREQARE-------TRDEADEVLEEHEE 248
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   325 QcskqEDDIKALETELADLDAAWRSFEKQIEEeilHKKRDIELEasqlDRYKELKEQVRKKVATMtqQLEKLqwEQKTDE 404
Cdd:PRK02224  249 R----REELETLEAEIEDLRETIAETEREREE---LAEEVRDLR----ERLEELEEERDDLLAEA--GLDDA--DAEAVE 313
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410   405 ERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEFNEELNLIRSEL 484
Cdd:PRK02224  314 ARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEI 393
                         250       260       270
                  ....*....|....*....|....*....|.
gi 57015410   485 QN-----AGIDTHEGKRQQKRAEVLEHLKRL 510
Cdd:PRK02224  394 EElrerfGDAPVDLGNAEDFLEELREERDEL 424
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
137-509 2.12e-04

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694  Cd Length: 1311  Bit Score: 45.42  E-value: 2.12e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    137 QGTVESISVKKPKERTQFFEEISTSGELIG----EYEEKKRKLQKAEEDAQfnfNKKKNIAAERRQAKLEKEEAERYQSL 212
Cdd:TIGR00606  711 LKSTESELKKKEKRRDEMLGLAPGRQSIIDlkekEIPELRNKLQKVNRDIQ---RLKNDIEEQETLLGTIMPEEESAKVC 787
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57015410    213 LEELKMnkIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENIVKARK-KEHGMLTRQLQQTEkelksvetll 291
Cdd:TIGR00606  788 LTDVTI--MERFQMELKDV