NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|89886484|ref|NP_775954|]
View 

XK-related protein 6 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
XK-related pfam09815
XK-related protein; Members of this family comprise various XK-related proteins, that are ...
130-501 8.42e-145

XK-related protein; Members of this family comprise various XK-related proteins, that are involved in sodium-dependent transport of neutral amino acids or oligopeptides. These proteins are responsible for the Kx blood group system - defects results in McLeod syndrome, an X-linked multi-system disorder characterized by late onset abnormalities in the neuromuscular and hematopoietic systems.


:

Pssm-ID: 401682  Cd Length: 337  Bit Score: 423.56  E-value: 8.42e-145
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   130 LWIVLALLVFFGDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDYTGGGLGAVEgltsrgppmmga 209
Cdd:pfam09815   1 LFTVLSLLLYLADLGTDIWLAVEYYSEGDYVWFGLTLLFILLPSLVVQIFSLRWYLDDLSKDRTKVEK------------ 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   210 gyvhgaarggpgvrvsptpgaqrlcrlsVWIWQSVIHLLQMGQVWRYIRTMYLGIQSQRRKEH---QRRFYWAMM-YEYA 285
Cdd:pfam09815  69 ----------------------------SWPLLLLLHLLQLGPLLRYWEALYYGFKSRKAKERkeeEIGYYERKLvYEEA 120
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   286 DVNMLRLLETFLESAPQLVLQLYIMLQKNSAETLP--CVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFW 363
Cdd:pfam09815 121 DLSMLRLFEAFLESAPQLILQLYILLQTGQAEVLVlqAVSIALSLVSIAWALVSYHRSLRLSLPDKLKLGWLGTLVQFLW 200
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   364 RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVGIVYIFCWFNVKEGRTRYRMF 443
Cdd:pfam09815 201 RLLTIASRVLALALFASVFPLWVLVVLLLHWLVMTFWIVFQQTDFCGSKVEEILYRLLVGAIYIFCFFNVKEGRTRYRMA 280
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 89886484   444 AYYTIVLTENAALTFLWYFYRDPETTDSYAVPALcCVFISFVAGIAMMLLYYGVLHPT 501
Cdd:pfam09815 281 IYYVVMLLENILLLLLWWFKKDSLTSDCYLLVLL-VVLAGFLLGILFMLLYYQFFHPN 337
PRK06975 super family cl35524
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed
82-138 9.30e-04

bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed


The actual alignment was detected with superfamily member PRK06975:

Pssm-ID: 235899 [Multi-domain]  Cd Length: 656  Bit Score: 42.40  E-value: 9.30e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 89886484   82 PRRSAAADGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLdcLWIVLALLV 138
Cdd:PRK06975 280 SRMTDTNDSKSVTSQPAAAAAAPAPPPNPPATPPEPPARRGRGSAA--LWFVVVVLA 334
 
Name Accession Description Interval E-value
XK-related pfam09815
XK-related protein; Members of this family comprise various XK-related proteins, that are ...
130-501 8.42e-145

XK-related protein; Members of this family comprise various XK-related proteins, that are involved in sodium-dependent transport of neutral amino acids or oligopeptides. These proteins are responsible for the Kx blood group system - defects results in McLeod syndrome, an X-linked multi-system disorder characterized by late onset abnormalities in the neuromuscular and hematopoietic systems.


Pssm-ID: 401682  Cd Length: 337  Bit Score: 423.56  E-value: 8.42e-145
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   130 LWIVLALLVFFGDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDYTGGGLGAVEgltsrgppmmga 209
Cdd:pfam09815   1 LFTVLSLLLYLADLGTDIWLAVEYYSEGDYVWFGLTLLFILLPSLVVQIFSLRWYLDDLSKDRTKVEK------------ 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   210 gyvhgaarggpgvrvsptpgaqrlcrlsVWIWQSVIHLLQMGQVWRYIRTMYLGIQSQRRKEH---QRRFYWAMM-YEYA 285
Cdd:pfam09815  69 ----------------------------SWPLLLLLHLLQLGPLLRYWEALYYGFKSRKAKERkeeEIGYYERKLvYEEA 120
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   286 DVNMLRLLETFLESAPQLVLQLYIMLQKNSAETLP--CVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFW 363
Cdd:pfam09815 121 DLSMLRLFEAFLESAPQLILQLYILLQTGQAEVLVlqAVSIALSLVSIAWALVSYHRSLRLSLPDKLKLGWLGTLVQFLW 200
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   364 RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVGIVYIFCWFNVKEGRTRYRMF 443
Cdd:pfam09815 201 RLLTIASRVLALALFASVFPLWVLVVLLLHWLVMTFWIVFQQTDFCGSKVEEILYRLLVGAIYIFCFFNVKEGRTRYRMA 280
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 89886484   444 AYYTIVLTENAALTFLWYFYRDPETTDSYAVPALcCVFISFVAGIAMMLLYYGVLHPT 501
Cdd:pfam09815 281 IYYVVMLLENILLLLLWWFKKDSLTSDCYLLVLL-VVLAGFLLGILFMLLYYQFFHPN 337
PRK06975 PRK06975
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed
82-138 9.30e-04

bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed


Pssm-ID: 235899 [Multi-domain]  Cd Length: 656  Bit Score: 42.40  E-value: 9.30e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 89886484   82 PRRSAAADGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLdcLWIVLALLV 138
Cdd:PRK06975 280 SRMTDTNDSKSVTSQPAAAAAAPAPPPNPPATPPEPPARRGRGSAA--LWFVVVVLA 334
CopL_fam NF033807
CopL family metal-binding regulatory protein; The founding member of this family was shown to ...
48-125 2.27e-03

CopL family metal-binding regulatory protein; The founding member of this family was shown to be involved in the copper-responsive expression of a multicopper oxidase copA encoded downstream. The regulatory function likely involves copper-binding, but activity as a DNA-binding transcriptional regulator was not demonstrated directly.


Pssm-ID: 411387  Cd Length: 129  Bit Score: 38.47  E-value: 2.27e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 89886484   48 PGESSSMHICHCCNTSSCYWGCRSAClrsllgrkprrSAAADGGdqPLQPPAAPGAGRQPPTPSAARPEPPPPQVERP 125
Cdd:NF033807  62 PAADHDPHADDCCKSGSCDCACAQHC-----------SAALPTL--PALPAHLPGSLAVAAPLLSGHPSPALPHLFRP 126
 
Name Accession Description Interval E-value
XK-related pfam09815
XK-related protein; Members of this family comprise various XK-related proteins, that are ...
130-501 8.42e-145

XK-related protein; Members of this family comprise various XK-related proteins, that are involved in sodium-dependent transport of neutral amino acids or oligopeptides. These proteins are responsible for the Kx blood group system - defects results in McLeod syndrome, an X-linked multi-system disorder characterized by late onset abnormalities in the neuromuscular and hematopoietic systems.


Pssm-ID: 401682  Cd Length: 337  Bit Score: 423.56  E-value: 8.42e-145
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   130 LWIVLALLVFFGDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDYTGGGLGAVEgltsrgppmmga 209
Cdd:pfam09815   1 LFTVLSLLLYLADLGTDIWLAVEYYSEGDYVWFGLTLLFILLPSLVVQIFSLRWYLDDLSKDRTKVEK------------ 68
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   210 gyvhgaarggpgvrvsptpgaqrlcrlsVWIWQSVIHLLQMGQVWRYIRTMYLGIQSQRRKEH---QRRFYWAMM-YEYA 285
Cdd:pfam09815  69 ----------------------------SWPLLLLLHLLQLGPLLRYWEALYYGFKSRKAKERkeeEIGYYERKLvYEEA 120
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   286 DVNMLRLLETFLESAPQLVLQLYIMLQKNSAETLP--CVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFW 363
Cdd:pfam09815 121 DLSMLRLFEAFLESAPQLILQLYILLQTGQAEVLVlqAVSIALSLVSIAWALVSYHRSLRLSLPDKLKLGWLGTLVQFLW 200
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89886484   364 RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVGIVYIFCWFNVKEGRTRYRMF 443
Cdd:pfam09815 201 RLLTIASRVLALALFASVFPLWVLVVLLLHWLVMTFWIVFQQTDFCGSKVEEILYRLLVGAIYIFCFFNVKEGRTRYRMA 280
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 89886484   444 AYYTIVLTENAALTFLWYFYRDPETTDSYAVPALcCVFISFVAGIAMMLLYYGVLHPT 501
Cdd:pfam09815 281 IYYVVMLLENILLLLLWWFKKDSLTSDCYLLVLL-VVLAGFLLGILFMLLYYQFFHPN 337
PRK06975 PRK06975
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed
82-138 9.30e-04

bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed


Pssm-ID: 235899 [Multi-domain]  Cd Length: 656  Bit Score: 42.40  E-value: 9.30e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 89886484   82 PRRSAAADGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLdcLWIVLALLV 138
Cdd:PRK06975 280 SRMTDTNDSKSVTSQPAAAAAAPAPPPNPPATPPEPPARRGRGSAA--LWFVVVVLA 334
CopL_fam NF033807
CopL family metal-binding regulatory protein; The founding member of this family was shown to ...
48-125 2.27e-03

CopL family metal-binding regulatory protein; The founding member of this family was shown to be involved in the copper-responsive expression of a multicopper oxidase copA encoded downstream. The regulatory function likely involves copper-binding, but activity as a DNA-binding transcriptional regulator was not demonstrated directly.


Pssm-ID: 411387  Cd Length: 129  Bit Score: 38.47  E-value: 2.27e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 89886484   48 PGESSSMHICHCCNTSSCYWGCRSAClrsllgrkprrSAAADGGdqPLQPPAAPGAGRQPPTPSAARPEPPPPQVERP 125
Cdd:NF033807  62 PAADHDPHADDCCKSGSCDCACAQHC-----------SAALPTL--PALPAHLPGSLAVAAPLLSGHPSPALPHLFRP 126
PHA03247 PHA03247
large tegument protein UL36; Provisional
89-125 4.14e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 40.31  E-value: 4.14e-03
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 89886484    89 DGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERP 125
Cdd:PHA03247 2903 DQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRP 2939
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH