NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1327848670|ref|NP_077744|]
View 

Wilms tumor protein isoform D [Homo sapiens]

Protein Classification

WT1 and COG5048 domain-containing protein (domain architecture ID 12031809)

WT1 and COG5048 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WT1 pfam02165
Wilm's tumor protein;
74-394 5.96e-167

Wilm's tumor protein;


:

Pssm-ID: 308009  Cd Length: 289  Bit Score: 473.64  E-value: 5.96e-167
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670  74 MGSDVRDLNALLPAVPSL---GGGGGCALPVSGAAQWAPVLDFAPpgASAYGSLGGPapppapppppppppHSFIKQEPS 150
Cdd:pfam02165   1 MGSDVRDLNLLLPAVPVPslpGAGGGCGLPVGGAGQWTPMLDFHP--GSPYSSLPSH--------------HSFIKQEPS 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 151 WGGAEPHEE-QC-LSAFTVHFSGQFTGTaGACRYGPFGPPPPSQAssgqaRMFPNAPYLPSCLESQPAIRNQGYSTVTFD 228
Cdd:pfam02165  65 WGTADPHEDpHCgLGAFTVHFSGQFTGT-GACRYGAFGEPPSSQP-----RMFPNGPYLPSCMDSQPTPRNQGYGTVAFD 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 229 GTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLEC 308
Cdd:pfam02165 139 GNPSYGHTPSHHTPQFSNHSFKHEDTLSPQNSIGDQQYPVPPPVYGCHTPSDSCTSSQALLLRNPYNSDNLYQMASQLEC 218
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 309 MTWNQMN-LGATLKGvaagssssvkwtegqsnHSTGYESDNHTTPI--LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVR 385
Cdd:pfam02165 219 VTWNQMNsLASTIKS-----------------HATSYDSDPHSPPMvySCSTQYHIHTHGVFRGLQDVRRVPGITPPIVK 281

                  ....*....
gi 1327848670 386 SaSETSEKR 394
Cdd:pfam02165 282 S-SEASEKR 289
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
386-514 5.15e-08

FOG: Zn-finger [General function prediction only];


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.09  E-value: 5.15e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 386 SASETSEKRPFMCayPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPF-QCKTCQRK 464
Cdd:COG5048    24 LKSLSNAPRPDSC--PNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNNPSDlNSKSLPLS 101
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1327848670 465 FSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRN 514
Cdd:COG5048   102 NSKASSSSLSSSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPL 151
 
Name Accession Description Interval E-value
WT1 pfam02165
Wilm's tumor protein;
74-394 5.96e-167

Wilm's tumor protein;


Pssm-ID: 308009  Cd Length: 289  Bit Score: 473.64  E-value: 5.96e-167
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670  74 MGSDVRDLNALLPAVPSL---GGGGGCALPVSGAAQWAPVLDFAPpgASAYGSLGGPapppapppppppppHSFIKQEPS 150
Cdd:pfam02165   1 MGSDVRDLNLLLPAVPVPslpGAGGGCGLPVGGAGQWTPMLDFHP--GSPYSSLPSH--------------HSFIKQEPS 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 151 WGGAEPHEE-QC-LSAFTVHFSGQFTGTaGACRYGPFGPPPPSQAssgqaRMFPNAPYLPSCLESQPAIRNQGYSTVTFD 228
Cdd:pfam02165  65 WGTADPHEDpHCgLGAFTVHFSGQFTGT-GACRYGAFGEPPSSQP-----RMFPNGPYLPSCMDSQPTPRNQGYGTVAFD 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 229 GTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLEC 308
Cdd:pfam02165 139 GNPSYGHTPSHHTPQFSNHSFKHEDTLSPQNSIGDQQYPVPPPVYGCHTPSDSCTSSQALLLRNPYNSDNLYQMASQLEC 218
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 309 MTWNQMN-LGATLKGvaagssssvkwtegqsnHSTGYESDNHTTPI--LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVR 385
Cdd:pfam02165 219 VTWNQMNsLASTIKS-----------------HATSYDSDPHSPPMvySCSTQYHIHTHGVFRGLQDVRRVPGITPPIVK 281

                  ....*....
gi 1327848670 386 SaSETSEKR 394
Cdd:pfam02165 282 S-SEASEKR 289
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
386-514 5.15e-08

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.09  E-value: 5.15e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 386 SASETSEKRPFMCayPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPF-QCKTCQRK 464
Cdd:COG5048    24 LKSLSNAPRPDSC--PNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNNPSDlNSKSLPLS 101
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1327848670 465 FSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRN 514
Cdd:COG5048   102 NSKASSSSLSSSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPL 151
zf-H2C2_2 pfam13465
Zinc-finger double domain;
443-467 1.81e-05

Zinc-finger double domain;


Pssm-ID: 338759 [Multi-domain]  Cd Length: 26  Bit Score: 41.18  E-value: 1.81e-05
                          10        20
                  ....*....|....*....|....*
gi 1327848670 443 LKRHQRRHTGVKPFQCKTCQRKFSR 467
Cdd:pfam13465   2 LKRHMRTHTGEKPYKCPECGKSFKS 26
 
Name Accession Description Interval E-value
WT1 pfam02165
Wilm's tumor protein;
74-394 5.96e-167

Wilm's tumor protein;


Pssm-ID: 308009  Cd Length: 289  Bit Score: 473.64  E-value: 5.96e-167
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670  74 MGSDVRDLNALLPAVPSL---GGGGGCALPVSGAAQWAPVLDFAPpgASAYGSLGGPapppapppppppppHSFIKQEPS 150
Cdd:pfam02165   1 MGSDVRDLNLLLPAVPVPslpGAGGGCGLPVGGAGQWTPMLDFHP--GSPYSSLPSH--------------HSFIKQEPS 64
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 151 WGGAEPHEE-QC-LSAFTVHFSGQFTGTaGACRYGPFGPPPPSQAssgqaRMFPNAPYLPSCLESQPAIRNQGYSTVTFD 228
Cdd:pfam02165  65 WGTADPHEDpHCgLGAFTVHFSGQFTGT-GACRYGAFGEPPSSQP-----RMFPNGPYLPSCMDSQPTPRNQGYGTVAFD 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 229 GTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLEC 308
Cdd:pfam02165 139 GNPSYGHTPSHHTPQFSNHSFKHEDTLSPQNSIGDQQYPVPPPVYGCHTPSDSCTSSQALLLRNPYNSDNLYQMASQLEC 218
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 309 MTWNQMN-LGATLKGvaagssssvkwtegqsnHSTGYESDNHTTPI--LCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVR 385
Cdd:pfam02165 219 VTWNQMNsLASTIKS-----------------HATSYDSDPHSPPMvySCSTQYHIHTHGVFRGLQDVRRVPGITPPIVK 281

                  ....*....
gi 1327848670 386 SaSETSEKR 394
Cdd:pfam02165 282 S-SEASEKR 289
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
386-514 5.15e-08

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 55.09  E-value: 5.15e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 386 SASETSEKRPFMCayPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPF-QCKTCQRK 464
Cdd:COG5048    24 LKSLSNAPRPDSC--PNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNNPSDlNSKSLPLS 101
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 1327848670 465 FSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRN 514
Cdd:COG5048   102 NSKASSSSLSSSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPL 151
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
454-515 1.47e-06

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 50.46  E-value: 1.47e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1327848670 454 KPFQCKTCQRKFSRSDHLKTHTRTHTGktsEKPFSCRWPSCQKKFARSDELVRHHNMHQRNM 515
Cdd:COG5048    32 RPDSCPNCTDSFSRLEHLTRHIRSHTG---EKPSQCSYSGCDKSFSRPLELSRHLRTHHNNP 90
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
386-514 6.58e-06

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 48.54  E-value: 6.58e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 386 SASETSEKRPFMCAYpgCNKRYFKLSHLQMHSRK--HTGE--KPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKT- 460
Cdd:COG5048   280 SSSEKGFSLPIKSKQ--CNISFSRSSPLTRHLRSvnHSGEslKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLl 357
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 461 -CQRKFSRSDHLKTHTRTH-----------------------TGKTSEKPFS---------CRWPSCQKKFARSDELVRH 507
Cdd:COG5048   358 nSSSKFSPLLNNEPPQSLQqykdlkndkksetlsnscirnfkRDSNLSLHIIthlsfrpynCKNPPCSKSFNRHYNLIPH 437

                  ....*..
gi 1327848670 508 HNMHQRN 514
Cdd:COG5048   438 KKIHTNH 444
zf-H2C2_2 pfam13465
Zinc-finger double domain;
443-467 1.81e-05

Zinc-finger double domain;


Pssm-ID: 338759 [Multi-domain]  Cd Length: 26  Bit Score: 41.18  E-value: 1.81e-05
                          10        20
                  ....*....|....*....|....*
gi 1327848670 443 LKRHQRRHTGVKPFQCKTCQRKFSR 467
Cdd:pfam13465   2 LKRHMRTHTGEKPYKCPECGKSFKS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
391-476 2.32e-05

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 46.61  E-value: 2.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 391 SEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCqRKFSRSDH 470
Cdd:COG5048   382 KNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPLLCSIL-KSFRRDLD 460

                  ....*.
gi 1327848670 471 LKTHTR 476
Cdd:COG5048   461 LSNHGK 466
COG5048 COG5048
FOG: Zn-finger [General function prediction only];
401-514 2.47e-05

FOG: Zn-finger [General function prediction only];


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 46.61  E-value: 2.47e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 401 PGCNKRYFKLSHLQMHSRKHTG-EKPYQCdfKDCERRFSRSDQLKRHQR--RHTG--VKPFQC--KTCQRKFSRSDHLKT 473
Cdd:COG5048   264 SLPTASSQSSSPNESDSSSEKGfSLPIKS--KQCNISFSRSSPLTRHLRsvNHSGesLKPFSCpySLCGKLFSRNDALKR 341
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 1327848670 474 HTRTHTGKtseKPFSCRWPSCQKKFARSDELVRHHNMHQRN 514
Cdd:COG5048   342 HILLHTSI---SPAKEKLLNSSSKFSPLLNNEPPQSLQQYK 379
zf-H2C2_2 pfam13465
Zinc-finger double domain;
412-439 8.52e-05

Zinc-finger double domain;


Pssm-ID: 338759 [Multi-domain]  Cd Length: 26  Bit Score: 39.26  E-value: 8.52e-05
                          10        20
                  ....*....|....*....|....*...
gi 1327848670 412 HLQMHSRKHTGEKPYQCDFkdCERRFSR 439
Cdd:pfam13465   1 NLKRHMRTHTGEKPYKCPE--CGKSFKS 26
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
456-478 1.27e-04

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 333835 [Multi-domain]  Cd Length: 23  Bit Score: 38.82  E-value: 1.27e-04
                          10        20
                  ....*....|....*....|...
gi 1327848670 456 FQCKTCQRKFSRSDHLKTHTRTH 478
Cdd:pfam00096   1 YKCPDCGKSFSRKSNLKRHLRTH 23
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
390-479 3.99e-04

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 42.78  E-value: 3.99e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1327848670 390 TSEKRPFMCAYPGCNKRYFKLSHLQMHsRKHTGEKPYQCDFKDCErrfsrsdqlkRHQRRHTGVKPFQCKTCQRKFSRSD 469
Cdd:COG5189   344 VKDGKPYKCPVEGCNKKYKNQNGLKYH-MLHGHQNQKLHENPSPE----------KMNIFSAKDKPYRCEVCDKRYKNLN 412
                          90
                  ....*....|
gi 1327848670 470 HLKTHtRTHT 479
Cdd:COG5189   413 GLKYH-RKHS 421
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
426-450 9.65e-04

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 333835 [Multi-domain]  Cd Length: 23  Bit Score: 36.51  E-value: 9.65e-04
                          10        20
                  ....*....|....*....|....*
gi 1327848670 426 YQCdfKDCERRFSRSDQLKRHQRRH 450
Cdd:pfam00096   1 YKC--PDCGKSFSRKSNLKRHLRTH 23
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH