NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|9945320|ref|NP_064703.1|]
View 

cyclin-L1 isoform 1 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CCL1 super family cl28538
Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision ...
74-274 8.02e-30

Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair];


The actual alignment was detected with superfamily member COG5333:

Pssm-ID: 333358  Cd Length: 297  Bit Score: 119.07  E-value: 8.02e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320   74 LDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRdvinvf 153
Cdd:COG5333  36 LTLEKELNLVIYYLKLIMDLCTRLNLPQTVLATAILFFSRFYLKNSVEEISLYSVVTTCVYLACKVEDTPRDIS------ 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320  154 hhLRQLRgKRTPSPLILDqnyiNTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLR 233
Cdd:COG5333 110 --IESFE-ARDLWSEEPK----SSRERILEYEFELLEALDFDLHVHHPYKYLEGFLKDLQEKDKYKLLQIAWKIINDALR 182
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 9945320  234 TNVFVRFQPETIACACIYLAARAlqIPLPTRPHWFLLFGTT 274
Cdd:COG5333 183 TDLCLLYPPHIIALAALLIACEV--LGMPIIKLLDFVSYET 221
 
Name Accession Description Interval E-value
CCL1 COG5333
Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision ...
74-274 8.02e-30

Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair];


Pssm-ID: 227640  Cd Length: 297  Bit Score: 119.07  E-value: 8.02e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320   74 LDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRdvinvf 153
Cdd:COG5333  36 LTLEKELNLVIYYLKLIMDLCTRLNLPQTVLATAILFFSRFYLKNSVEEISLYSVVTTCVYLACKVEDTPRDIS------ 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320  154 hhLRQLRgKRTPSPLILDqnyiNTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLR 233
Cdd:COG5333 110 --IESFE-ARDLWSEEPK----SSRERILEYEFELLEALDFDLHVHHPYKYLEGFLKDLQEKDKYKLLQIAWKIINDALR 182
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 9945320  234 TNVFVRFQPETIACACIYLAARAlqIPLPTRPHWFLLFGTT 274
Cdd:COG5333 183 TDLCLLYPPHIIALAALLIACEV--LGMPIIKLLDFVSYET 221
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
82-154 1.08e-10

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 59.56  E-value: 1.08e-10
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 9945320   82 LRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFH 154
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTG 73
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
205-274 1.10e-09

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 56.45  E-value: 1.10e-09
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     205 IVMYLQVLECerNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTT 274
Cdd:smart00385   3 LRRVCKALNL--DPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGYFT 70
ccl1 TIGR00569
cyclin ccl1; All proteins in this family for which functions are known are cyclins that are ...
99-264 8.59e-06

cyclin ccl1; All proteins in this family for which functions are known are cyclins that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, StanfordUniversity). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129660  Cd Length: 305  Bit Score: 47.52  E-value: 8.59e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     99 LPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEaprrirdvinVFHHLRQLRGKRTPSPLildqnyiNTK 178
Cdd:TIGR00569  74 MPTSVVGTAIMYFKRFYLNNSVMEYHPKIIMLTCVFLACKVEE----------FNVSIDQFVGNLKETPL-------KAL 136
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320    179 NQVIKAERRVLKELGFCVHVKHPHKIIVMYLqvLEC-------ERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIY 251
Cdd:TIGR00569 137 EQVLEYELLLIQQLNFHLIVHNPYRPLEGFL--IDIktrlpglENPEYLRKHADKFLNRTLLTDAYLLYTPSQIALAAIL 214
                         170
                  ....*....|...
gi 9945320    252 LAARALQIPLPTR 264
Cdd:TIGR00569 215 HTASRAGLNMESY 227
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Cyclin-0 (CCNO) ...
54-196 1.35e-05

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Cyclin-0 (CCNO) is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 306612  Cd Length: 127  Bit Score: 44.81  E-value: 1.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     54 IDHSLIPEERLSPTPSMQDGLDLPSETDLRILgCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACI 133
Cdd:pfam00134   3 FQYLLELELKYLPPPDYMDQQPELNPRMRAIL-IDWLVEVHEKFKLLPETLYLAVNYLDRFLSKQSVPKTKLQLVGITCL 81
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 9945320    134 NLASKIEE-APRRIRDVInvfhhlrqlrgkrtpspLILDQNYinTKNQVIKAERRVLKELGFCV 196
Cdd:pfam00134  82 FIAAKYEEiYPPTVKDFV-----------------YITDNAY--TREEILRMERLILETLNFDL 126
 
Name Accession Description Interval E-value
CCL1 COG5333
Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision ...
74-274 8.02e-30

Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair];


Pssm-ID: 227640  Cd Length: 297  Bit Score: 119.07  E-value: 8.02e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320   74 LDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRdvinvf 153
Cdd:COG5333  36 LTLEKELNLVIYYLKLIMDLCTRLNLPQTVLATAILFFSRFYLKNSVEEISLYSVVTTCVYLACKVEDTPRDIS------ 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320  154 hhLRQLRgKRTPSPLILDqnyiNTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLR 233
Cdd:COG5333 110 --IESFE-ARDLWSEEPK----SSRERILEYEFELLEALDFDLHVHHPYKYLEGFLKDLQEKDKYKLLQIAWKIINDALR 182
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
gi 9945320  234 TNVFVRFQPETIACACIYLAARAlqIPLPTRPHWFLLFGTT 274
Cdd:COG5333 183 TDLCLLYPPHIIALAALLIACEV--LGMPIIKLLDFVSYET 221
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
82-154 1.08e-10

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 59.56  E-value: 1.08e-10
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 9945320   82 LRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFH 154
Cdd:cd00043   1 MRPTPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLKDLVHVTG 73
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
205-274 1.10e-09

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 56.45  E-value: 1.10e-09
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     205 IVMYLQVLECerNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTT 274
Cdd:smart00385   3 LRRVCKALNL--DPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTGYFT 70
CYCLIN cd00043
Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. ...
197-264 1.58e-09

Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.


Pssm-ID: 238003  Cd Length: 88  Bit Score: 56.09  E-value: 1.58e-09
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 9945320  197 HVKHPHKIIVMYLQVLECerNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTR 264
Cdd:cd00043   1 MRPTPLDFLRRVAKALGL--SPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPWLK 66
CYCLIN smart00385
domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and ...
90-190 1.31e-07

domain present in cyclins, TFIIB and Retinoblastoma; A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.


Pssm-ID: 214641  Cd Length: 83  Bit Score: 50.28  E-value: 1.31e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320      90 IQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFHhlrqlrgkrtpspli 169
Cdd:smart00385   3 LRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLASKTEETPPWTKELVHYTG--------------- 67
                           90       100
                   ....*....|....*....|.
gi 9945320     170 ldqnyINTKNQVIKAERRVLK 190
Cdd:smart00385  68 -----YFTEEEILRMERLLLE 83
ccl1 TIGR00569
cyclin ccl1; All proteins in this family for which functions are known are cyclins that are ...
99-264 8.59e-06

cyclin ccl1; All proteins in this family for which functions are known are cyclins that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, StanfordUniversity). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129660  Cd Length: 305  Bit Score: 47.52  E-value: 8.59e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     99 LPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEaprrirdvinVFHHLRQLRGKRTPSPLildqnyiNTK 178
Cdd:TIGR00569  74 MPTSVVGTAIMYFKRFYLNNSVMEYHPKIIMLTCVFLACKVEE----------FNVSIDQFVGNLKETPL-------KAL 136
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320    179 NQVIKAERRVLKELGFCVHVKHPHKIIVMYLqvLEC-------ERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIY 251
Cdd:TIGR00569 137 EQVLEYELLLIQQLNFHLIVHNPYRPLEGFL--IDIktrlpglENPEYLRKHADKFLNRTLLTDAYLLYTPSQIALAAIL 214
                         170
                  ....*....|...
gi 9945320    252 LAARALQIPLPTR 264
Cdd:TIGR00569 215 HTASRAGLNMESY 227
Cyclin_N pfam00134
Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Cyclin-0 (CCNO) ...
54-196 1.35e-05

Cyclin, N-terminal domain; Cyclins regulate cyclin dependent kinases (CDKs). Cyclin-0 (CCNO) is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain.


Pssm-ID: 306612  Cd Length: 127  Bit Score: 44.81  E-value: 1.35e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9945320     54 IDHSLIPEERLSPTPSMQDGLDLPSETDLRILgCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACI 133
Cdd:pfam00134   3 FQYLLELELKYLPPPDYMDQQPELNPRMRAIL-IDWLVEVHEKFKLLPETLYLAVNYLDRFLSKQSVPKTKLQLVGITCL 81
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 9945320    134 NLASKIEE-APRRIRDVInvfhhlrqlrgkrtpspLILDQNYinTKNQVIKAERRVLKELGFCV 196
Cdd:pfam00134  82 FIAAKYEEiYPPTVKDFV-----------------YITDNAY--TREEILRMERLILETLNFDL 126
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH